Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283093_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of A-549 cells using 3 ug Kaiso/ZBTB33 antibody (AAA283093). Western blot was performed from the immunoprecipitate using Kaiso/ZBTB33 antibody (AAA283093) at a dilution of 1:1000.)

Rabbit anti-Human Kaiso/ZBTB33 Monoclonal Antibody | anti-ZBTB33 antibody

Kaiso/ZBTB33 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
Kaiso/ZBTB33, Antibody; Kaiso/ZBTB33 Rabbit mAb; ZNF348; ZNF-kaiso; Kaiso/ZBTB33; anti-ZBTB33 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
HSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY
Applicable Applications for anti-ZBTB33 antibody
ELISA, IP (Immunoprecipitation), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Cross Reactivity
Human, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 573-672 of human Kaiso/ZBTB33 (Q86T24).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of A-549 cells using 3 ug Kaiso/ZBTB33 antibody (AAA283093). Western blot was performed from the immunoprecipitate using Kaiso/ZBTB33 antibody (AAA283093) at a dilution of 1:1000.)

product-image-AAA283093_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of A-549 cells using 3 ug Kaiso/ZBTB33 antibody (AAA283093). Western blot was performed from the immunoprecipitate using Kaiso/ZBTB33 antibody (AAA283093) at a dilution of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using Kaiso/ZBTB33 Rabbit mAb (AAA283093) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283093_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using Kaiso/ZBTB33 Rabbit mAb (AAA283093) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of various lysates using Kaiso/ZBTB33 Rabbit mAb (AAA283093) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA283093_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using Kaiso/ZBTB33 Rabbit mAb (AAA283093) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-ZBTB33 antibody
This gene encodes a transcriptional regulator with bimodal DNA-binding specificity, which binds to methylated CGCG and also to the non-methylated consensus KAISO-binding site TCCTGCNA. The protein contains an N-terminal POZ/BTB domain and 3 C-terminal zinc finger motifs. It recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. It may contribute to the repression of target genes of the Wnt signaling pathway, and may also activate transcription of a subset of target genes by the recruitment of catenin delta-2 (CTNND2). Its interaction with catenin delta-1 (CTNND1) inhibits binding to both methylated and non-methylated DNA. It also interacts directly with the nuclear import receptor Importin-alpha2 (also known as karyopherin alpha2 or RAG cohort 1), which may mediate nuclear import of this protein. Alternatively spliced transcript variants encoding the same protein have been identified.
Product Categories/Family for anti-ZBTB33 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 74KDa
Observed MW: 80kDa
UniProt Protein Name
Transcriptional regulator Kaiso
UniProt Gene Name
ZBTB33
UniProt Synonym Gene Names
KAISO; ZNF348
UniProt Entry Name
KAISO_HUMAN

Similar Products

Product Notes

The ZBTB33 zbtb33 (Catalog #AAA283093) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Kaiso/ZBTB33 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Kaiso/ZBTB33 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the ZBTB33 zbtb33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HSQDPSGDSK LYRLHPCRSL QIRQYAYLSD RSSTIPAMKD DGIGYKVDTG KEPPVGTTTS TQNKPMTWED IFIQQENDSI FKQNVTDGST EFEFIIPESY. It is sometimes possible for the material contained within the vial of "Kaiso/ZBTB33, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.