Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26113_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse MCM3 Monoclonal Antibody | anti-MCM3 antibody

MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (APC)

Average rating 0.0
No ratings yet
Gene Names
MCM3; HCC5; P1.h; RLFB; P1-MCM3
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
MCM3, Antibody; MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (APC); Minichromosome Maintenance Complex Component 3; HCC5; MGC1157; P1-MCM3; P1.h; RLFB; anti-MCM3 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H3
Specificity
Recognizes MCM3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MCM3 antibody
IF (Immunofluorescence), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MCM3 (NP_002379, 699aa-808aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26113_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26113_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 ug/ml])

Application Data

(Detection limit for recombinant GST tagged MCM3 is approximately 0.1ng/ml as a capture antibody.)

product-image-AAA26113_APP4.jpg Application Data (Detection limit for recombinant GST tagged MCM3 is approximately 0.1ng/ml as a capture antibody.)

WB (Western Blot)

(MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Y-79.)

product-image-AAA26113_WB3.jpg WB (Western Blot) (MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Y-79.)

WB (Western Blot)

(MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in human ovarian cancer.)

product-image-AAA26113_WB2.jpg WB (Western Blot) (MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in human ovarian cancer.)

WB (Western Blot)

(MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Hela S3 NE.)

product-image-AAA26113_WB.jpg WB (Western Blot) (MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Hela S3 NE.)
Related Product Information for anti-MCM3 antibody
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq]
Product Categories/Family for anti-MCM3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95,908 Da
NCBI Official Full Name
DNA replication licensing factor MCM3 isoform 1
NCBI Official Synonym Full Names
minichromosome maintenance complex component 3
NCBI Official Symbol
MCM3
NCBI Official Synonym Symbols
HCC5; P1.h; RLFB; P1-MCM3
NCBI Protein Information
DNA replication licensing factor MCM3; DNA polymerase alpha holoenzyme-associated protein P1; DNA replication factor MCM3; MCM3 minichromosome maintenance deficient 3; RLF subunit beta; cervical cancer proto-oncogene 5; hRlf beta subunit; p102; replicatio
UniProt Protein Name
DNA replication licensing factor MCM3
UniProt Gene Name
MCM3
UniProt Entry Name
MCM3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MCM3 mcm3 (Catalog #AAA26113) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MCM3 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MCM3 mcm3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MCM3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.