Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283350_DB11.jpg DB (Dot Blot) (Dot-blot analysis of all sorts of peptides using MonoMethyl-Histone H3-R2 antibody (AAA283350) at 1:1000 dilution.)

Rabbit anti-Human MonoMethyl-Histone H3-R2 Monoclonal Antibody | anti-H3 antibody

MonoMethyl-Histone H3-R2 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Dot Blot, Western Blot
Purity
Affinity purification
Synonyms
MonoMethyl-Histone H3-R2, Antibody; MonoMethyl-Histone H3-R2 Rabbit mAb; H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-R2; anti-H3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Applicable Applications for anti-H3 antibody
ELISA, DB (Dot Blot), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat, Other (Wide Range Predicted)
Immunogen
A synthetic monomethylated peptide around R2 of human Histone H3 (Q16695).
Modification
MonoMethyl R2
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

DB (Dot Blot)

(Dot-blot analysis of all sorts of peptides using MonoMethyl-Histone H3-R2 antibody (AAA283350) at 1:1000 dilution.)

product-image-AAA283350_DB11.jpg DB (Dot Blot) (Dot-blot analysis of all sorts of peptides using MonoMethyl-Histone H3-R2 antibody (AAA283350) at 1:1000 dilution.)

WB (Western Blot)

(Western blot analysis of various lysates using MonoMethyl-Histone H3-R2 Rabbit mAb (AAA283350) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA283350_WB13.jpg WB (Western Blot) (Western blot analysis of various lysates using MonoMethyl-Histone H3-R2 Rabbit mAb (AAA283350) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Application Data

(CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10? K562 cells with 1 ug MonoMethyl-Histone H3-R2 antibody (AAA283350) , along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of H3R2me1 in representative gene loci (MYOD1), as shown in figure.)

product-image-AAA283350_AD15.jpg Application Data (CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10? K562 cells with 1 ug MonoMethyl-Histone H3-R2 antibody (AAA283350) , along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of H3R2me1 in representative gene loci (MYOD1), as shown in figure.)
Related Product Information for anti-H3 antibody
This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.
Product Categories/Family for anti-H3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 16kDa
Observed MW: 17kDa
UniProt Protein Name
Histone H3.1t
UniProt Gene Name
HIST3H3
UniProt Synonym Gene Names
H3FT; H3/t; H3t
UniProt Entry Name
H31T_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The H3 hist3h3 (Catalog #AAA283350) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MonoMethyl-Histone H3-R2 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MonoMethyl-Histone H3-R2 can be used in a range of immunoassay formats including, but not limited to, ELISA, DB (Dot Blot), WB (Western Blot). Researchers should empirically determine the suitability of the H3 hist3h3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MARTKQTARK STGGKAPRKQ LATKAARKSA PATGGVKKPH RYRPGTVALR EIRRYQKSTE LLIRKLPFQR LVREIAQDFK TDLRFQSSAV MALQEACEAY. It is sometimes possible for the material contained within the vial of "MonoMethyl-Histone H3-R2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.