Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25172_APP7.jpg Application Data (Detection limit for recombinant GST tagged NDUFA9 is ~0.1ng/ml as a capture antibody.)

Mouse NDUFA9 Monoclonal Antibody | anti-NDUFA9 antibody

NDUFA9 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 9, Mitochondrial, NADH-Ubiquinone Oxidoreductase 39kD Subunit, Complex I-39kD, CI-39kD, NDUFS2L, MGC111043) (FITC)

Average rating 0.0
No ratings yet
Gene Names
NDUFA9; CC6; CI39k; CI-39k; MC1DN26; NDUFS2L; SDR22E1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFA9, Antibody; NDUFA9 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 9, Mitochondrial, NADH-Ubiquinone Oxidoreductase 39kD Subunit, Complex I-39kD, CI-39kD, NDUFS2L, MGC111043) (FITC); anti-NDUFA9 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D7
Specificity
Recognizes human NDUFA9. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NDUFA9 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa303-377 from human NDUFA9 (NP_004993) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged NDUFA9 is ~0.1ng/ml as a capture antibody.)

product-image-AAA25172_APP7.jpg Application Data (Detection limit for recombinant GST tagged NDUFA9 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to NDUFA9 on NIH/3T3 cell. [antibody concentration 10ug/ml])

product-image-AAA25172_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to NDUFA9 on NIH/3T3 cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.8ug/ml])

product-image-AAA25172_IHC5.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.8ug/ml])

WB (Western Blot)

(NDUFA9 monoclonal antibody Western Blot analysis of NDUFA9 expression in NIH/3T3.)

product-image-AAA25172_WB4.jpg WB (Western Blot) (NDUFA9 monoclonal antibody Western Blot analysis of NDUFA9 expression in NIH/3T3.)

WB (Western Blot)

(NDUFA9 monoclonal antibody. Western Blot analysis of NDUFA9 expression in Raw 264.7.)

product-image-AAA25172_WB3.jpg WB (Western Blot) (NDUFA9 monoclonal antibody. Western Blot analysis of NDUFA9 expression in Raw 264.7.)

WB (Western Blot)

(NDUFA9 monoclonal antibody Western Blot analysis of NDUFA9 expression in PC-12.)

product-image-AAA25172_WB2.jpg WB (Western Blot) (NDUFA9 monoclonal antibody Western Blot analysis of NDUFA9 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (33.99kD).)

product-image-AAA25172_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (33.99kD).)
Product Categories/Family for anti-NDUFA9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit A9
NCBI Official Symbol
NDUFA9
NCBI Official Synonym Symbols
CC6; CI39k; CI-39k; MC1DN26; NDUFS2L; SDR22E1
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
UniProt Gene Name
NDUFA9
UniProt Synonym Gene Names
NDUFS2L; CI-39kD
UniProt Entry Name
NDUA9_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NDUFA9 ndufa9 (Catalog #AAA25172) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDUFA9 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 9, Mitochondrial, NADH-Ubiquinone Oxidoreductase 39kD Subunit, Complex I-39kD, CI-39kD, NDUFS2L, MGC111043) (FITC) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA9 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFA9 ndufa9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFA9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.