Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25764_WB6.jpg WB (Western Blot) (Western Blot analysis of NDUFV2 expression in transfected 293T cell line by NDUFV2 monoclonal antibody. Lane 1: NDUFV2 transfected lysate (Predicted MW: 27.4kD). Lane 2: Non-transfected lysate.)

Mouse NDUFV2 Monoclonal Antibody | anti-NDUFV2 antibody

NDUFV2 (NADH Dehydrogenase [Ubiquinone] Flavoprotein 2, Mitochondrial, NADH-ubiquinone Oxidoreductase 24kD Subunit) (PE)

Gene Names
NDUFV2; CI-24k
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFV2, Antibody; NDUFV2 (NADH Dehydrogenase [Ubiquinone] Flavoprotein 2, Mitochondrial, NADH-ubiquinone Oxidoreductase 24kD Subunit) (PE); anti-NDUFV2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A10
Specificity
Recognizes human NDUFV2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NDUFV2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa150-249 from human NDUFV2 (NP_066552) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of NDUFV2 expression in transfected 293T cell line by NDUFV2 monoclonal antibody. Lane 1: NDUFV2 transfected lysate (Predicted MW: 27.4kD). Lane 2: Non-transfected lysate.)

product-image-AAA25764_WB6.jpg WB (Western Blot) (Western Blot analysis of NDUFV2 expression in transfected 293T cell line by NDUFV2 monoclonal antibody. Lane 1: NDUFV2 transfected lysate (Predicted MW: 27.4kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(NDUFV2 monoclonal antibody Western Blot analysis of NDUFV2 expression in K-562.)

product-image-AAA25764_WB5.jpg WB (Western Blot) (NDUFV2 monoclonal antibody Western Blot analysis of NDUFV2 expression in K-562.)

WB (Western Blot)

(NDUFV2 monoclonal antibody Western Blot analysis of NDUFV2 expression in NIH/3T3.)

product-image-AAA25764_WB4.jpg WB (Western Blot) (NDUFV2 monoclonal antibody Western Blot analysis of NDUFV2 expression in NIH/3T3.)

WB (Western Blot)

(NDUFV2 monoclonal antibody Western Blot analysis of NDUFV2 expression in Raw 264.7.)

product-image-AAA25764_WB3.jpg WB (Western Blot) (NDUFV2 monoclonal antibody Western Blot analysis of NDUFV2 expression in Raw 264.7.)

WB (Western Blot)

(NDUFV2 monoclonal antibody Western Blot analysis of NDUFV2 expression in PC-12.)

product-image-AAA25764_WB2.jpg WB (Western Blot) (NDUFV2 monoclonal antibody Western Blot analysis of NDUFV2 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

product-image-AAA25764_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Related Product Information for anti-NDUFV2 antibody
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for anti-NDUFV2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.1 kDa (240aa) confirmed by MALDI-TOF
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase core subunit V2
NCBI Official Symbol
NDUFV2
NCBI Official Synonym Symbols
CI-24k
NCBI Protein Information
NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
UniProt Gene Name
NDUFV2
UniProt Entry Name
NDUV2_HUMAN

Similar Products

Product Notes

The NDUFV2 ndufv2 (Catalog #AAA25764) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDUFV2 (NADH Dehydrogenase [Ubiquinone] Flavoprotein 2, Mitochondrial, NADH-ubiquinone Oxidoreductase 24kD Subunit) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFV2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFV2 ndufv2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFV2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.