Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA126894_FACS8.png FCM/FACS (Flow Cytometry) (Figure 5. Flow Cytometry analysis of Neuro-2a cells using anti-NFIB/NF1B2 antibody (AAA126894).Overlay histogram showing Neuro-2a cells stained with AAA126894 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NFIB/NF1B2 Antibody (AAA126894, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse NFIB/NF1B2 Monoclonal Antibody | anti-NFIB antibody

Anti-NFIB/NF1B2 Antibody Picoband (monoclonal, 4D6E4)

Gene Names
NFIB; CTF; NF1-B; NFI-B; NFIB2; NFIB3; NF-I/B; NFI-RED; HMGIC/NFIB
Reactivity
Human, Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Immunofluorescence, Immunocytochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
NFIB/NF1B2, Antibody; Anti-NFIB/NF1B2 Antibody Picoband (monoclonal, 4D6E4); anti-NFIB antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
4D6E4
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-NFIB antibody
FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), WB (Western Blot)
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence of human NFIB/NF1B2 (ELVRVS RTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR).
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 5. Flow Cytometry analysis of Neuro-2a cells using anti-NFIB/NF1B2 antibody (AAA126894).Overlay histogram showing Neuro-2a cells stained with AAA126894 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NFIB/NF1B2 Antibody (AAA126894, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126894_FACS8.png FCM/FACS (Flow Cytometry) (Figure 5. Flow Cytometry analysis of Neuro-2a cells using anti-NFIB/NF1B2 antibody (AAA126894).Overlay histogram showing Neuro-2a cells stained with AAA126894 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NFIB/NF1B2 Antibody (AAA126894, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 4. Flow Cytometry analysis of C6 cells using anti-NFIB/NF1B2 antibody (AAA126894).Overlay histogram showing C6 cells stained with AAA126894 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NFIB/NF1B2 Antibody (AAA126894, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126894_FCM10.png FCM/FACS (Flow Cytometry) (Figure 4. Flow Cytometry analysis of C6 cells using anti-NFIB/NF1B2 antibody (AAA126894).Overlay histogram showing C6 cells stained with AAA126894 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NFIB/NF1B2 Antibody (AAA126894, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of A431 cells using anti-NFIB/NF1B2 antibody (AAA126894).Overlay histogram showing A431 cells stained with AAA126894 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NFIB/NF1B2 Antibody (AAA126894, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126894_FCM11.png FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of A431 cells using anti-NFIB/NF1B2 antibody (AAA126894).Overlay histogram showing A431 cells stained with AAA126894 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-NFIB/NF1B2 Antibody (AAA126894, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 2. IF analysis of NFIB/NF1B2 using anti-NFIB/NF1B2 antibody (AAA126894).NFIB/NF1B2 was detected in an immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-NFIB/NF1B2 Antibody (AAA126894) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA126894_IF13.jpg IF (Immunofluorescence) (Figure 2. IF analysis of NFIB/NF1B2 using anti-NFIB/NF1B2 antibody (AAA126894).NFIB/NF1B2 was detected in an immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-NFIB/NF1B2 Antibody (AAA126894) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

WB (Western Blot)

(Figure 1. Western blot analysis of NFIB/NF1B2 using anti-NFIB/NF1B2 antibody (AAA126894).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human MCF-7 whole cell lysates,Lane 3: human HepG2 whole cell lysates,Lane 4: human 293T whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-NFIB/NF1B2 antigen affinity purified monoclonal antibody (#AAA126894) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for NFIB/NF1B2 at approximately 68 kDa. The expected band size for NFIB/NF1B2 is at 68 kDa.)

product-image-AAA126894_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of NFIB/NF1B2 using anti-NFIB/NF1B2 antibody (AAA126894).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human MCF-7 whole cell lysates,Lane 3: human HepG2 whole cell lysates,Lane 4: human 293T whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-NFIB/NF1B2 antigen affinity purified monoclonal antibody (#AAA126894) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for NFIB/NF1B2 at approximately 68 kDa. The expected band size for NFIB/NF1B2 is at 68 kDa.)
Related Product Information for anti-NFIB antibody
Nuclear factor 1 B-type is a protein that in humans is encoded by the NFIB gene. The NFIB gene is a part of the NFI gene complex that includes three other genes (NFIA, NFIC and NFIX). The NFIB gene is a protein coding gene that also serves as a transcription factor. This gene is essential in embryonic development and it works together with its gene complex to initiate tissue differentiation in the fetus. Through knockout experiments, researchers found that mice without the NFIB gene have severely underdeveloped lungs. This mutation does not seem to cause spontaneous abortions because in utero the fetus does not use its lungs for respiration. However, this becomes lethal once the fetus is born and has to take its first breath. It is thought that NFIB plays a role in down regulating the transcription factors TGF-beta1 and Shh in normal gestation because they remained high in knockout experiments. The absence of NFIB also leads to insufficient amounts of surfactant being produced which is one reason why the mice cannot breathe once it is born. The knockout experiments demonstrated that NFIB has a significant role in fore-brain development. NFIB is typically found in pontine nuclei of the CNS, the cerebral cortex and the white matter of the brain and without NFIB these areas are dramatically affected.
Product Categories/Family for anti-NFIB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
420
NCBI Official Full Name
Nuclear factor 1 B-type
NCBI Official Synonym Full Names
nuclear factor I/B
NCBI Official Symbol
NFIB
NCBI Official Synonym Symbols
CTF; NF1-B; NFI-B; NFIB2; NFIB3; NF-I/B; NFI-RED; HMGIC/NFIB
NCBI Protein Information
nuclear factor 1 B-type; nuclear factor 1/B; TGGCA-binding protein; CCAAT-box-binding transcription factor
UniProt Protein Name
Nuclear factor 1 B-type
UniProt Gene Name
NFIB
UniProt Synonym Gene Names
NF1-B; Nuclear factor 1/B; CTF; NF-I/B; NFI-B
UniProt Entry Name
NFIB_HUMAN

Similar Products

Product Notes

The NFIB nfib (Catalog #AAA126894) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-NFIB/NF1B2 Antibody Picoband (monoclonal, 4D6E4) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFIB/NF1B2 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NFIB nfib for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFIB/NF1B2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.