WB (Western Blot)
(Western blot analysis of various lysates, using NUP155 Rabbit mAb (AAA282890) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Rabbit anti-Human NUP155 Monoclonal Antibody | anti-NUP155 antibody
NUP155 Rabbit mAb
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
NUP155, Antibody; NUP155 Rabbit mAb; N155; ATFB15; NUP155; anti-NUP155 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
LKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLAD
Applicable Applications for anti-NUP155 antibody
ELISA, WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 901-1050 of human NUP155 (NP_705618.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of various lysates, using NUP155 Rabbit mAb (AAA282890) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of various lysates, using NUP155 Rabbit mAb (AAA282890) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of lysates from Jurkat cells, using NUP155 Rabbit mAb (AAA282890) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of lysates from Jurkat cells, using NUP155 Rabbit mAb (AAA282890) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-NUP155 antibody
Nucleoporins are proteins that play an important role in the assembly and functioning of the nuclear pore complex (NPC) which regulates the movement of macromolecules across the nuclear envelope (NE). The protein encoded by this gene plays a role in the fusion of NE vesicles and formation of the double membrane NE. The protein may also be involved in cardiac physiology and may be associated with the pathogenesis of atrial fibrillation. Alternative splicing results in multiple transcript variants of this gene. A pseudogene associated with this gene is located on chromosome 6.
Product Categories/Family for anti-NUP155 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 155kDa
Observed MW: 155kDa
Observed MW: 155kDa
UniProt Protein Name
Nuclear pore complex protein Nup155
UniProt Gene Name
NUP155
UniProt Synonym Gene Names
KIAA0791
UniProt Entry Name
NU155_HUMAN
Similar Products
Product Notes
The NUP155 nup155 (Catalog #AAA282890) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUP155 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUP155 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the NUP155 nup155 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LKEYQKISNQ VDLSNVCAQY RQVRFYEGVV ELSLTAAEKK DPQGLGLHFY KHGEPEEDIV GLQAFQERLN SYKCITDTLQ ELVNQSKAAP QSPSVPKKPG PPVLSSDPNM LSNEEAGHHF EQMLKLSQRS KDELFSIALY NWLIQVDLAD. It is sometimes possible for the material contained within the vial of "NUP155, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.