Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282986_WB13.jpg WB (Western Blot) (Western blot analysis of various lysates using NUP98 Rabbit mAb (AAA282986) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Rabbit anti-Human NUP98 Monoclonal Antibody | anti-NUP98 antibody

NUP98 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
NUP98, Antibody; NUP98 Rabbit mAb; ADIR2; NUP96; NUP196; Nup98-96; NUP98; anti-NUP98 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
DESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQF
Applicable Applications for anti-NUP98 antibody
ELISA, WB (Western Blot)
Cross Reactivity
Human, Mouse, Monkey
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 712-863 of human NUP98. (NP_001352055.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of various lysates using NUP98 Rabbit mAb (AAA282986) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA282986_WB13.jpg WB (Western Blot) (Western blot analysis of various lysates using NUP98 Rabbit mAb (AAA282986) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of lysates from HeLa cells, using NUP98 Rabbit mAb (AAA282986) at 1:6000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA282986_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from HeLa cells, using NUP98 Rabbit mAb (AAA282986) at 1:6000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-NUP98 antibody
Nuclear pore complexes (NPCs) regulate the transport of macromolecules between the nucleus and cytoplasm, and are composed of many polypeptide subunits, many of which belong to the nucleoporin family. This gene belongs to the nucleoporin gene family and encodes a 186 kDa precursor protein that undergoes autoproteolytic cleavage to generate a 98 kDa nucleoporin and 96 kDa nucleoporin. The 98 kDa nucleoporin contains a Gly-Leu-Phe-Gly (GLGF) repeat domain and participates in many cellular processes, including nuclear import, nuclear export, mitotic progression, and regulation of gene expression. The 96 kDa nucleoporin is a scaffold component of the NPC. Proteolytic cleavage is important for targeting of the proteins to the NPC. Translocations between this gene and many other partner genes have been observed in different leukemias. Rearrangements typically result in chimeras with the N-terminal GLGF domain of this gene to the C-terminus of the partner gene. Alternative splicing results in multiple transcript variants encoding different isoforms, at least two of which are proteolytically processed. Some variants lack the region that encodes the 96 kDa nucleoporin.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 198kDa
Observed MW: 98kDa/
UniProt Protein Name
Nuclear pore complex protein Nup98-Nup96
UniProt Gene Name
NUP98
UniProt Synonym Gene Names
ADAR2; Nup98; Nup96
UniProt Entry Name
NUP98_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NUP98 nup98 (Catalog #AAA282986) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUP98 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUP98 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the NUP98 nup98 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DESLQDDREE IENNSYHMHP AGIILTKVGY YTIPSMDDLA KITNEKGECI VSDFTIGRKG YGSIYFEGDV NLTNLNLDDI VHIRRKEVVV YLDDNQKPPV GEGLNRKAEV TLDGVWPTDK TSRCLIKSPD RLADINYEGR LEAVSRKQGA QF. It is sometimes possible for the material contained within the vial of "NUP98, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.