Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25777_WB6.jpg WB (Western Blot) (P15RS monoclonal antibody. Western Blot analysis of P15RS expression in NIH/3T3.)

Mouse P15RS Monoclonal Antibody | anti-P15RS antibody

P15RS (RPRD1A, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1A, Cyclin-dependent Kinase Inhibitor 2B-related Protein, p15INK4B-related Protein, FLJ10656, HsT3101, MGC19513) (PE)

Gene Names
RPRD1A; P15RS; HsT3101
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
P15RS, Antibody; P15RS (RPRD1A, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1A, Cyclin-dependent Kinase Inhibitor 2B-related Protein, p15INK4B-related Protein, FLJ10656, HsT3101, MGC19513) (PE); anti-P15RS antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B8
Specificity
Recognizes human P15RS. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-P15RS antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa76-171 from human P15RS (NP_060640) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(P15RS monoclonal antibody. Western Blot analysis of P15RS expression in NIH/3T3.)

product-image-AAA25777_WB6.jpg WB (Western Blot) (P15RS monoclonal antibody. Western Blot analysis of P15RS expression in NIH/3T3.)

Application Data

(Detection limit for recombinant GST tagged P15RS is ~0.03ng/ml as a capture antibody.)

product-image-AAA25777_APP5.jpg Application Data (Detection limit for recombinant GST tagged P15RS is ~0.03ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to P15RS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)

product-image-AAA25777_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to P15RS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml].)

WB (Western Blot)

(P15RS monoclonal antibody, Western Blot analysis of P15RS expression in A-431.)

product-image-AAA25777_WB3.jpg WB (Western Blot) (P15RS monoclonal antibody, Western Blot analysis of P15RS expression in A-431.)

WB (Western Blot)

(P15RS monoclonal antibody. Western Blot analysis of P15RS expression in PC-12.)

product-image-AAA25777_WB2.jpg WB (Western Blot) (P15RS monoclonal antibody. Western Blot analysis of P15RS expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.56kD).)

product-image-AAA25777_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.56kD).)
Product Categories/Family for anti-P15RS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.4kDa (337aa) confirmed by MALDI-TOF
NCBI Official Full Name
regulation of nuclear pre-mRNA domain-containing protein 1A isoform 1
NCBI Official Synonym Full Names
regulation of nuclear pre-mRNA domain containing 1A
NCBI Official Symbol
RPRD1A
NCBI Official Synonym Symbols
P15RS; HsT3101
NCBI Protein Information
regulation of nuclear pre-mRNA domain-containing protein 1A
UniProt Protein Name
Regulation of nuclear pre-mRNA domain-containing protein 1A
UniProt Gene Name
RPRD1A
UniProt Synonym Gene Names
P15RS

Similar Products

Product Notes

The P15RS rprd1a (Catalog #AAA25777) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The P15RS (RPRD1A, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1A, Cyclin-dependent Kinase Inhibitor 2B-related Protein, p15INK4B-related Protein, FLJ10656, HsT3101, MGC19513) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's P15RS can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the P15RS rprd1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "P15RS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.