Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

Application Data (Detection limit for recombinant GST tagged PCAF is approximately 3ng/ml as a capture antibody.)

Mouse PCAF Monoclonal Antibody | anti-PCAF antibody

PCAF (K(Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (Biotin)

Gene Names
KAT2B; CAF; PCAF; P/CAF
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
PCAF; Monoclonal Antibody; PCAF (K(Lysine) Acetyltransferase 2B; CAF; P; P/CAF; PCAF) (Biotin); K(Lysine) Acetyltransferase 2B; anti-PCAF antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
500000
Specificity
Recognizes PCAF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
832
Applicable Applications for anti-PCAF antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PCAF (AAH60823, 353aa-452aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPME
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged PCAF is approximately 3ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged PCAF is approximately 3ng/ml as a capture antibody.)

WB (Western Blot)

(PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in human uterus myoma.)

WB (Western Blot) (PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in human uterus myoma.)

WB (Western Blot)

(PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in C32.)

WB (Western Blot) (PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in C32.)

WB (Western Blot)

(PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in A-431.)

WB (Western Blot) (PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in A-431.)

WB (Western Blot)

(PCAF monoclonal antibody (M06), clone 5E5 Western Blot analysis of PCAF expression in Hela S3 NE.)

WB (Western Blot) (PCAF monoclonal antibody (M06), clone 5E5 Western Blot analysis of PCAF expression in Hela S3 NE.)

WB (Western Blot)

(PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in human thyroid(diffuse hyperplasia).)

WB (Western Blot) (PCAF monoclonal antibody (M06), clone 5E5. Western Blot analysis of PCAF expression in human thyroid(diffuse hyperplasia).)
Related Product Information for anti-PCAF antibody
CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. [provided by RefSeq]
Product Categories/Family for anti-PCAF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
K(lysine) acetyltransferase 2B
NCBI Official Synonym Full Names
lysine acetyltransferase 2B
NCBI Official Symbol
KAT2B
NCBI Official Synonym Symbols
CAF; PCAF; P/CAF
NCBI Protein Information
histone acetyltransferase KAT2B

Similar Products

Product Notes

The PCAF (Catalog #AAA26210) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PCAF can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCAF for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCAF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.