Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26687_APP6.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between STAT1 and PDGFRB Mahlavu cells were stained with anti-STAT1 rabbit purified polyclonal (1:1200) and (1:50). Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Mouse anti-Human PDGFRB Monoclonal Antibody | anti-PDGFRB antibody

PDGFRB (PDGFR, PDGFR1, Platelet-derived Growth Factor Receptor beta, Beta Platelet-derived Growth Factor Receptor, Beta-type Platelet-derived Growth Factor Receptor, CD140 Antigen-like Family Member B, Platelet-derived Growth Factor Receptor 1, CD140b) (M

Gene Names
PDGFRB; IMF1; KOGS; IBGC4; JTK12; PDGFR; PENTT; CD140B; PDGFR1; PDGFR-1
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDGFRB, Antibody; PDGFRB (PDGFR, PDGFR1, Platelet-derived Growth Factor Receptor beta, Beta Platelet-derived Growth Factor Receptor, Beta-type Platelet-derived Growth Factor Receptor, CD140 Antigen-like Family Member B, Platelet-derived Growth Factor Receptor 1, CD140b) (M; anti-PDGFRB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C12
Specificity
Recognizes human PDGFRB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-PDGFRB antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa33-133 from human PDGFRB (AAH32224) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAE
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Proximity Ligation Analysis of protein-protein interactions between STAT1 and PDGFRB Mahlavu cells were stained with anti-STAT1 rabbit purified polyclonal (1:1200) and (1:50). Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

product-image-AAA26687_APP6.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between STAT1 and PDGFRB Mahlavu cells were stained with anti-STAT1 rabbit purified polyclonal (1:1200) and (1:50). Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Application Data

(Detection limit for recombinant GST tagged PDGFRB is ~1ng/ml as a capture antibody.)

product-image-AAA26687_APP5.jpg Application Data (Detection limit for recombinant GST tagged PDGFRB is ~1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of PDGFRB transfected lysate using and Protein A Magnetic Bead, and immunoblotted with PDGFRB rabbit polyclonal antibody.)

product-image-AAA26687_IP4.jpg IP (Immunoprecipitation) (Immunoprecipitation of PDGFRB transfected lysate using and Protein A Magnetic Bead, and immunoblotted with PDGFRB rabbit polyclonal antibody.)

WB (Western Blot)

(Western Blot analysis of PDGFRB expression in human uterus myoma using.)

product-image-AAA26687_WB3.jpg WB (Western Blot) (Western Blot analysis of PDGFRB expression in human uterus myoma using.)

WB (Western Blot)

(Western Blot analysis of PDGFRB expression in human stomach using.)

product-image-AAA26687_WB2.jpg WB (Western Blot) (Western Blot analysis of PDGFRB expression in human stomach using.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

product-image-AAA26687_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Related Product Information for anti-PDGFRB antibody
CD140b is a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The identity of the growth factor bound to the receptor determines whether the functional receptor is a homodimer or heterodimer composed of both PDGFR-a and -B. CD140b contains two immunoglobulin-like domains and a tyrosine kinase domain with a predicted molecular weight ~124kD. CD140b is widely expressed on a variety of mesenchymal-derived cells and is preferentially expressed on some tumors such as medulloblastoma. Binding of B-chain containing PDGF molecules can stimulate cell proliferation. CD140b has been shown to interact with a number of kinases (including Raf-1, NCK1, FAK, Fyn, others) as well as adaptor molecules and signaling intermediates (Crk, Grb2, Grb4, RasGAP, SHP2, SHC1, others), and has also been shown to associate with integrin B3 and nexin sorting molecules. CD140b has been implicated in several disease states including atherogenesis and oncogenesis. The PDGFRB is heavily phosphorylated on numerous tyrosine residues through both autophosphorylation and ligand-dependent processes.
Product Categories/Family for anti-PDGFRB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
37,412 Da
NCBI Official Full Name
Homo sapiens platelet-derived growth factor receptor, beta polypeptide, mRNA
NCBI Official Synonym Full Names
platelet derived growth factor receptor beta
NCBI Official Symbol
PDGFRB
NCBI Official Synonym Symbols
IMF1; KOGS; IBGC4; JTK12; PDGFR; PENTT; CD140B; PDGFR1; PDGFR-1
NCBI Protein Information
platelet-derived growth factor receptor beta

Similar Products

Product Notes

The PDGFRB (Catalog #AAA26687) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDGFRB (PDGFR, PDGFR1, Platelet-derived Growth Factor Receptor beta, Beta Platelet-derived Growth Factor Receptor, Beta-type Platelet-derived Growth Factor Receptor, CD140 Antigen-like Family Member B, Platelet-derived Growth Factor Receptor 1, CD140b) (M reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDGFRB can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDGFRB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDGFRB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.