Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24603_WB6.jpg WB (Western Blot) (Western blot analysis of PDK2 over-expressed 293 cell line, cotransfected with PDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human PDHK2 Monoclonal Antibody | anti-PDHK2 antibody

PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2) APC

Gene Names
PDK2; PDHK2; PDKII
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDHK2, Antibody; PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2) APC; anti-PDHK2 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G1
Specificity
Recognizes human PDK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PDHK2 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 0.8ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa187-276 from human PDK2 (AAH05811) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western blot analysis of PDK2 over-expressed 293 cell line, cotransfected with PDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24603_WB6.jpg WB (Western Blot) (Western blot analysis of PDK2 over-expressed 293 cell line, cotransfected with PDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged PDK2 is ~0.3ng/ml as a capture antibody.)

product-image-AAA24603_APP5.jpg Application Data (Detection limit for recombinant GST tagged PDK2 is ~0.3ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 0.8ug/ml])

product-image-AAA24603_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 0.8ug/ml])

WB (Western Blot)

(Western Blot analysis of PDK2 expression in transfected 293T cell line by PDK2 monoclonal antibody. Lane 1: PDK2 transfected lysate (46.2kD). Lane 2: Non-transfected lysate.)

product-image-AAA24603_WB3.jpg WB (Western Blot) (Western Blot analysis of PDK2 expression in transfected 293T cell line by PDK2 monoclonal antibody. Lane 1: PDK2 transfected lysate (46.2kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(PDK2 monoclonal antibody Western Blot analysis of PDK2 expression in U-2 OS.)

product-image-AAA24603_WB2.jpg WB (Western Blot) (PDK2 monoclonal antibody Western Blot analysis of PDK2 expression in U-2 OS.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.31kD).)

product-image-AAA24603_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (35.31kD).)
Product Categories/Family for anti-PDHK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
38,864 Da
NCBI Official Full Name
Homo sapiens pyruvate dehydrogenase kinase, isozyme 2, mRNA
NCBI Official Synonym Full Names
pyruvate dehydrogenase kinase 2
NCBI Official Symbol
PDK2
NCBI Official Synonym Symbols
PDHK2; PDKII
NCBI Protein Information
pyruvate dehydrogenase kinase, isozyme 2
UniProt Protein Name
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial
UniProt Gene Name
PDK2
UniProt Synonym Gene Names
PDHK2; PDH kinase 2; PDKII
UniProt Entry Name
PDK2_HUMAN

Similar Products

Product Notes

The PDHK2 pdk2 (Catalog #AAA24603) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDHK2 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 0.8ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDHK2 pdk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDHK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.