Mouse PDK2 Monoclonal Antibody | anti-PDK2 antibody

PDK2 (Pyruvate Dehydrogenase Kinase, Isozyme 2, PDHK2) (FITC)

Cat. Num. AAA26329

• Gene Names: PDK2; PDHK2; PDKII
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: PDK2, Antibody; PDK2 (Pyruvate Dehydrogenase Kinase, Isozyme 2, PDHK2) (FITC); Pyruvate Dehydrogenase Kinase; Isozyme 2; PDHK2; anti-PDK2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5F8
• Specificity: Recognizes PDK2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 407

• Applicable Applications for anti-PDK2 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PDK2 (AAH05811, 187aa-276aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IHC (Immunohistchemistry)

(Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 2 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 2 ug/ml])

Application Data

(Detection limit for recombinant GST tagged PDK2 is approximately 0.03ng/ml as a capture antibody.)

WB (Western Blot)

(PDK2 monoclonal antibody (M02), clone 5F8. Western Blot analysis of PDK2 expression in A-431 (Cat # L015V1).)

WB (Western Blot)

(PDK2 monoclonal antibody (M02), clone 5F8. Western Blot analysis of PDK2 expression in 293 (Cat # L026V1).)

WB (Western Blot)

(PDK2 monoclonal antibody (M02), clone 5F8 Western Blot analysis of PDK2 expression in HeLa (Cat # L013V1).)

Related Product Information for anti-PDK2 antibody

Mouse monoclonal antibody raised against a partial recombinant PDK2.

Product Categories/Family for anti-PDK2 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 13543295
• NCBI GeneID: 5164
• NCBI Official Full Name: Pyruvate dehydrogenase kinase, isozyme 2
• NCBI Official Synonym Full Names: pyruvate dehydrogenase kinase 2
• NCBI Official Symbol: PDK2
• NCBI Official Synonym Symbols: PDHK2; PDKII
• NCBI Protein Information: pyruvate dehydrogenase kinase, isozyme 2