Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26192_APP6.jpg Application Data (Detection limit for recombinant GST tagged PGR is approximately 0.03ng/ml as a capture antibody.)

Mouse PGR Monoclonal Antibody | anti-PGR antibody

PGR (Progesterone Receptor, NR3C3, PR) (Biotin)

Average rating 0.0
No ratings yet
Gene Names
PGR; PR; NR3C3
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
PGR, Antibody; PGR (Progesterone Receptor, NR3C3, PR) (Biotin); Progesterone Receptor; NR3C3; PR; anti-PGR antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4.0e+9
Specificity
Recognizes PGR.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PGR antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PGR (NP_000917, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged PGR is approximately 0.03ng/ml as a capture antibody.)

product-image-AAA26192_APP6.jpg Application Data (Detection limit for recombinant GST tagged PGR is approximately 0.03ng/ml as a capture antibody.)

WB (Western Blot)

(PGR monoclonal antibody (M08), clone 4E9 Western Blot analysis of PGR expression in MCF-7.)

product-image-AAA26192_WB5.jpg WB (Western Blot) (PGR monoclonal antibody (M08), clone 4E9 Western Blot analysis of PGR expression in MCF-7.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PGR on MCF-7 cell. [antibody concentration 10 ug/ml])

product-image-AAA26192_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PGR on MCF-7 cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PGR on MCF-7 cell. [antibody concentration 10 ug/ml])

product-image-AAA26192_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PGR on MCF-7 cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml])

product-image-AAA26192_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml])

product-image-AAA26192_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml])
Related Product Information for anti-PGR antibody
This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform A only, and mediate their own response genes and physiologic effects with little overlap. The location of transcription initiation for isoform B has not been clearly determined. [provided by RefSeq]
Product Categories/Family for anti-PGR antibody
References
1. Comparison of estrogenic responses in bone and uterus depending on the parity status in Lewis rats. Keiler AM, Bernhardt R, Scharnweber D, Jarry H, Vollmer G, Zierau O.J Steroid Biochem Mol Biol. 2012 Sep 29. pii: S0960-0760(12)00189-6. doi: 10.1016/j.jsbmb.2012.09.023.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,747 Da
NCBI Official Full Name
progesterone receptor isoform B
NCBI Official Synonym Full Names
progesterone receptor
NCBI Official Symbol
PGR
NCBI Official Synonym Symbols
PR; NR3C3
NCBI Protein Information
progesterone receptor; nuclear receptor subfamily 3 group C member 3
UniProt Protein Name
Progesterone receptor
UniProt Gene Name
PGR
UniProt Synonym Gene Names
NR3C3; PR
UniProt Entry Name
PRGR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PGR pgr (Catalog #AAA26192) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PGR can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGR pgr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.