Loading...

Skip to main content
Application Data (Detection limit for recombinant GST tagged PITPNA is 0.1ng/ml as a capture antibody.)

Mouse PITPNA Monoclonal Antibody | anti-PITPNA antibody

PITPNA (Phosphatidylinositol Transfer Protein alpha Isoform, PI-TP-alpha, PtdIns Transfer Protein alpha, PtdInsTP alpha, PITPN, MGC99649) APC

Gene Names
PITPNA; PITPN; VIB1A; HEL-S-36; PI-TPalpha
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PITPNA, Antibody; PITPNA (Phosphatidylinositol Transfer Protein alpha Isoform, PI-TP-alpha, PtdIns Transfer Protein alpha, PtdInsTP alpha, PITPN, MGC99649) APC; anti-PITPNA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G10
Specificity
Recognizes human PITPNA. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PITPNA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa171-271 from human PITPNA (NP_006215) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged PITPNA is 0.1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged PITPNA is 0.1ng/ml as a capture antibody.)

WB (Western Blot)

(PITPNA monoclonal antibody Western Blot analysis of PITPNA expression in NIH/3T3)

WB (Western Blot) (PITPNA monoclonal antibody Western Blot analysis of PITPNA expression in NIH/3T3)

WB (Western Blot)

(PITPNA monoclonal antibody. Western Blot analysis of PITPNA expression in Raw 264.7)

WB (Western Blot) (PITPNA monoclonal antibody. Western Blot analysis of PITPNA expression in Raw 264.7)

WB (Western Blot)

(PITPNA monoclonal antibody. Western Blot analysis of PITPNA expression in HepG2)

WB (Western Blot) (PITPNA monoclonal antibody. Western Blot analysis of PITPNA expression in HepG2)

WB (Western Blot)

(PITPNA monoclonal antibody. Western Blot analysis of PITPNA expression in PC-12.)

WB (Western Blot) (PITPNA monoclonal antibody. Western Blot analysis of PITPNA expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Related Product Information for anti-PITPNA antibody
Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.
Product Categories/Family for anti-PITPNA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.9 kDa (290aa), confirmed by MALDI-TOF
NCBI Official Full Name
phosphatidylinositol transfer protein alpha isoform
NCBI Official Synonym Full Names
phosphatidylinositol transfer protein alpha
NCBI Official Symbol
PITPNA
NCBI Official Synonym Symbols
PITPN; VIB1A; HEL-S-36; PI-TPalpha
NCBI Protein Information
phosphatidylinositol transfer protein alpha isoform
UniProt Protein Name
Phosphatidylinositol transfer protein alpha isoform
UniProt Gene Name
PITPNA
UniProt Synonym Gene Names
PITPN; PI-TP-alpha; PtdIns transfer protein alpha; PtdInsTP alpha
UniProt Entry Name
PIPNA_HUMAN

Similar Products

Product Notes

The PITPNA pitpna (Catalog #AAA24614) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PITPNA (Phosphatidylinositol Transfer Protein alpha Isoform, PI-TP-alpha, PtdIns Transfer Protein alpha, PtdInsTP alpha, PITPN, MGC99649) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PITPNA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PITPNA pitpna for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PITPNA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.