Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24621_WB6.jpg WB (Western Blot) (Western blot analysis of POU4F3 over-expressed 293 cell line, cotransfected with POU4F3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with POU4F3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human POU4F3 Monoclonal Antibody | anti-POU4F3 antibody

POU4F3 (POU Domain, Class 4, Transcription Factor 3, Brain-specific Homeobox/POU Domain Protein 3C, Brain-3C, Brn-3C, BRN3C, MGC138412) APC

Average rating 0.0
No ratings yet
Gene Names
POU4F3; BRN3C; DFNA15; DFNA42; DFNA52
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POU4F3, Antibody; POU4F3 (POU Domain, Class 4, Transcription Factor 3, Brain-specific Homeobox/POU Domain Protein 3C, Brain-3C, Brn-3C, BRN3C, MGC138412) APC; anti-POU4F3 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B8
Specificity
Recognizes human POU4F3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-POU4F3 antibody
ELISA, IF (Immunofluorescence), WB (Western Blot)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa100-191 from human POU4F3 (NP_002691) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western blot analysis of POU4F3 over-expressed 293 cell line, cotransfected with POU4F3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with POU4F3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24621_WB6.jpg WB (Western Blot) (Western blot analysis of POU4F3 over-expressed 293 cell line, cotransfected with POU4F3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with POU4F3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged POU4F3 is ~0.1ng/ml as a capture antibody.)

product-image-AAA24621_APP5.jpg Application Data (Detection limit for recombinant GST tagged POU4F3 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to POU4F3 on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA24621_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to POU4F3 on HeLa cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(Western Blot analysis of POU4F3 expression in transfected 293T cell line by POU4F3 monoclonal antibody. Lane 1: POU4F3 transfected lysate (37.1kD). Lane 2: Non-transfected lysate.)

product-image-AAA24621_WB3.jpg WB (Western Blot) (Western Blot analysis of POU4F3 expression in transfected 293T cell line by POU4F3 monoclonal antibody. Lane 1: POU4F3 transfected lysate (37.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(POU4F3 monoclonal antibody Western Blot analysis of POU4F3 expression in HeLa NE.)

product-image-AAA24621_WB2.jpg WB (Western Blot) (POU4F3 monoclonal antibody Western Blot analysis of POU4F3 expression in HeLa NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.75kD).)

product-image-AAA24621_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (35.75kD).)
Product Categories/Family for anti-POU4F3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
POU domain, class 4, transcription factor 3
NCBI Official Synonym Full Names
POU class 4 homeobox 3
NCBI Official Symbol
POU4F3
NCBI Official Synonym Symbols
BRN3C; DFNA15; DFNA42; DFNA52
NCBI Protein Information
POU domain, class 4, transcription factor 3
UniProt Protein Name
POU domain, class 4, transcription factor 3
UniProt Gene Name
POU4F3
UniProt Synonym Gene Names
BRN3C; Brain-3C; Brn-3C
UniProt Entry Name
PO4F3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The POU4F3 pou4f3 (Catalog #AAA24621) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POU4F3 (POU Domain, Class 4, Transcription Factor 3, Brain-specific Homeobox/POU Domain Protein 3C, Brain-3C, Brn-3C, BRN3C, MGC138412) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POU4F3 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), WB (Western Blot). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POU4F3 pou4f3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POU4F3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.