Mouse anti-Human Procollagen III N-Terminal Propeptide (PIIINP) Monoclonal Antibody | anti-PIIINP antibody
Botin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
Gene Names
COL3A1; EDS4A; EDSVASC
Reactivity
Human
Applications
Immunofluorescence, Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Protein A + Protein G affinity chromatography.
Synonyms
Procollagen III N-Terminal Propeptide (PIIINP), Antibody; Botin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP); P3NP; N-Propeptide Of Type III Procollagen; Procollagen III Amino Terminal Propeptide; anti-PIIINP antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Clone Number
C2
Purity/Purification
Protein A + Protein G affinity chromatography.
Form/Format
Supplied as solution form in PBS, pH7.4, 50% glycerol 0.05% Proclin-300.
Concentration
1mg/mL (varies by lot)
Applicable Applications for anti-PIIINP antibody
IF (Immunofluorescence), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Source
Monoclonal antibody preparation
Label
Biotin
Unconjugated Antibody
MBS2025794
Traits
Liquid
Immunogen
Synthetic Peptide, PIIINP conjugated to OVA (MBS2086210).
Target peptide sequence
QEAVEGGCSHLGQSYADRDVWKPEPCQICV.
Preparation and Storage
Storage:
Avoid repeated freeze/thaw cycles.
Store at 4 degree C for frequent use.
Aliquot and store at -20 degree C for 24 months.
Stability Test:
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Avoid repeated freeze/thaw cycles.
Store at 4 degree C for frequent use.
Aliquot and store at -20 degree C for 24 months.
Stability Test:
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
collagen alpha-1(III) chain preproprotein
NCBI Official Synonym Full Names
collagen type III alpha 1 chain
NCBI Official Symbol
COL3A1
NCBI Official Synonym Symbols
EDS4A; EDSVASC
NCBI Protein Information
collagen alpha-1(III) chain
UniProt Protein Name
Collagen alpha-1(III) chain
UniProt Gene Name
COL3A1
UniProt Entry Name
CO3A1_HUMAN
Similar Products
Product Notes
The PIIINP col3a1 (Catalog #AAA149356) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Botin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Procollagen III N-Terminal Propeptide (PIIINP) can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PIIINP col3a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Procollagen III N-Terminal Propeptide (PIIINP), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.