Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19685_FCM8.png FCM (Flow Cytometry) (Figure 8. Flow Cytometry analysis of U937 cells using anti-Rab11A antibody (AAA19685).Overlay histogram showing U937 cells stained with AAA19685 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Rab11A Antibody (AAA19685, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse Rab11A Monoclonal Antibody | anti-RAB11A antibody

Anti-Rab11A Antibody Picoband (monoclonal, 4H9)

Average rating 0.0
No ratings yet
Gene Names
RAB11A; YL8
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
Rab11A, Antibody; Anti-Rab11A Antibody Picoband (monoclonal, 4H9); anti-RAB11A antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
4H9
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-RAB11A antibody
WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry)
Application Notes
WB: 0.25-0.5 ug/ml, Human, Mouse, Rat
IHC-P: 2-5 ug/ml, Human
ICC/IF: 5 ug/ml, Human
FC/FACS: 1-3 ug/1x10^6 cells, Human, Mouse, Rat
Tested Species: In-house tested species with positive results.
Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P) and ICC.
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 8. Flow Cytometry analysis of U937 cells using anti-Rab11A antibody (AAA19685).Overlay histogram showing U937 cells stained with AAA19685 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Rab11A Antibody (AAA19685, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19685_FCM8.png FCM (Flow Cytometry) (Figure 8. Flow Cytometry analysis of U937 cells using anti-Rab11A antibody (AAA19685).Overlay histogram showing U937 cells stained with AAA19685 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Rab11A Antibody (AAA19685, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM (Flow Cytometry)

(Figure 7. Flow Cytometry analysis of RH35 cells using anti-Rab11A antibody (AAA19685).Overlay histogram showing RH35 cells stained with AAA19685 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Rab11A Antibody (AAA19685, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19685_FCM7.png FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of RH35 cells using anti-Rab11A antibody (AAA19685).Overlay histogram showing RH35 cells stained with AAA19685 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Rab11A Antibody (AAA19685, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM (Flow Cytometry)

(Figure 6. Flow Cytometry analysis of ANA-1 cells using anti-Rab11A antibody (AAA19685).Overlay histogram showing ANA-1 cells stained with AAA19685 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Rab11A Antibody (AAA19685, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19685_FCM6.png FCM (Flow Cytometry) (Figure 6. Flow Cytometry analysis of ANA-1 cells using anti-Rab11A antibody (AAA19685).Overlay histogram showing ANA-1 cells stained with AAA19685 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Rab11A Antibody (AAA19685, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 5. IF analysis of Rab11A using anti-Rab11A antibody (AAA19685).Rab11A was detected in an immunocytochemical section of T-47D cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-Rab11A Antibody (AAA19685) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19685_IF5.jpg IF (Immunofluorescence) (Figure 5. IF analysis of Rab11A using anti-Rab11A antibody (AAA19685).Rab11A was detected in an immunocytochemical section of T-47D cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-Rab11A Antibody (AAA19685) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of Rab11A using anti-Rab11A antibody (AAA19685).Rab11A was detected in a paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Rab11A Antibody (AAA19685) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

product-image-AAA19685_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of Rab11A using anti-Rab11A antibody (AAA19685).Rab11A was detected in a paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Rab11A Antibody (AAA19685) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of Rab11A using anti-Rab11A antibody (AAA19685).Rab11A was detected in a paraffin-embedded section of human gastric carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Rab11A Antibody (AAA19685) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

product-image-AAA19685_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of Rab11A using anti-Rab11A antibody (AAA19685).Rab11A was detected in a paraffin-embedded section of human gastric carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Rab11A Antibody (AAA19685) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of Rab11A using anti-Rab11A antibody (AAA19685).Rab11A was detected in a paraffin-embedded section of human spleen tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Rab11A Antibody (AAA19685) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

product-image-AAA19685_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of Rab11A using anti-Rab11A antibody (AAA19685).Rab11A was detected in a paraffin-embedded section of human spleen tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-Rab11A Antibody (AAA19685) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (#SA1021) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of Rab11A using anti-Rab11A antibody (AAA19685).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human placenta tissue lysates,Lane 3: human Colo320 lysates,Lane 4: human MDA-MB453 whole cell lysates,Lane 5: rat testis tissue lysates,Lane 6: rat brain tissue lysates,Lane 7: mouse testis tissue lysates,Lane 8: mouse brain tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Rab11A antigen affinity purified monoclonal antibody (#AAA19685) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Rab11A at approximately 22 kDa. The expected band size for Rab11A is at 22 kDa.)

product-image-AAA19685_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of Rab11A using anti-Rab11A antibody (AAA19685).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human placenta tissue lysates,Lane 3: human Colo320 lysates,Lane 4: human MDA-MB453 whole cell lysates,Lane 5: rat testis tissue lysates,Lane 6: rat brain tissue lysates,Lane 7: mouse testis tissue lysates,Lane 8: mouse brain tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Rab11A antigen affinity purified monoclonal antibody (#AAA19685) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Rab11A at approximately 22 kDa. The expected band size for Rab11A is at 22 kDa.)
Related Product Information for anti-RAB11A antibody
Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.
Product Categories/Family for anti-RAB11A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
216
NCBI Official Full Name
ras-related protein Rab-11A isoform 2
NCBI Official Synonym Full Names
RAB11A, member RAS oncogene family
NCBI Official Symbol
RAB11A
NCBI Official Synonym Symbols
YL8
NCBI Protein Information
ras-related protein Rab-11A; rab-11; RAB 11A, member oncogene family
UniProt Protein Name
Ras-related protein Rab-11A
UniProt Gene Name
RAB11A
UniProt Synonym Gene Names
RAB11; Rab-11
UniProt Entry Name
RB11A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RAB11A rab11a (Catalog #AAA19685) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Rab11A Antibody Picoband (monoclonal, 4H9) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rab11A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry). WB: 0.25-0.5 ug/ml, Human, Mouse, Rat IHC-P: 2-5 ug/ml, Human ICC/IF: 5 ug/ml, Human FC/FACS: 1-3 ug/1x10^6 cells, Human, Mouse, Rat Tested Species: In-house tested species with positive results. Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P) and ICC. Researchers should empirically determine the suitability of the RAB11A rab11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Rab11A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.