Mouse RAB33B Monoclonal Antibody | anti-RAB33B antibody

RAB33B (Ras-related Protein Rab-33B, SMC2) (FITC)

Cat. Num. AAA25220

• Gene Names: RAB33B; SMC2
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAB33B, Antibody; RAB33B (Ras-related Protein Rab-33B, SMC2) (FITC); DKFZp434G099; MGC138182; anti-RAB33B antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6F4
• Specificity: Recognizes human RAB33B. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-RAB33B antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa117-207 from human RAB33B (NP_112586) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in NIH/3T3.)

Application Data

(Detection limit for recombinant GST tagged RAB33B is ~0.03ng/ml as a capture antibody.)

WB (Western Blot)

(RAB33B monoclonal antibody, Western Blot analysis of RAB33B expression in A-431.)

WB (Western Blot)

(RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in PC-12.)

WB (Western Blot)

(RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.01kD).)

Product Categories/Family for anti-RAB33B antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13786129
• NCBI GeneID: 83452
• NCBI Accession #: NP_112586
• NCBI GenBank Nucleotide #: NM_031296
• UniProt Accession #: Q9H082; Q4W5B0; B2R987
• Molecular Weight: 25,718 Da
• NCBI Official Full Name: ras-related protein Rab-33B
• NCBI Official Synonym Full Names: RAB33B, member RAS oncogene family
• NCBI Official Symbol: RAB33B
• NCBI Official Synonym Symbols: SMC2
• NCBI Protein Information: ras-related protein Rab-33B
• UniProt Protein Name: Ras-related protein Rab-33B
• UniProt Gene Name: RAB33B
• UniProt Entry Name: RB33B_HUMAN