Mouse anti-Human RAB7B Monoclonal Antibody | anti-RAB7B antibody
RAB7B (Ras-related Protein Rab-7b, RAB7) (AP)
Gene Names
RAB7B; RAB7
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB7B, Antibody; RAB7B (Ras-related Protein Rab-7b, RAB7) (AP); MGC16212; MGC9726; anti-RAB7B antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B3
Specificity
Recognizes human RAB7B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
199
Applicable Applications for anti-RAB7B antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa100-200 from human RAB7B (NP_796377) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-RAB7B antibody
References
1. Zlatic SA, Tornieri K, L'hernault SW, Faundez V.Mol Biol Cell. 2011 May;22(10):1699-715. Epub 2011 Mar 16. 2. Higashi S, Moore DJ, Yamamoto R, Minegishi M, Sato K, Togo T, Katsuse O, Uchikado H, Furukawa Y, Hino H, Kosaka K, Emson PC, Wada K, Dawson VL, Dawson TM, Arai H, Iseki E.J Neuropathol Exp Neurol. 2009 Sep;68(9):994-1005. 3.GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation. Higashi S, Iseki E, Minegishi M, Togo T, Kabuta T, Wada K.J Neurochem. 2010 Jul 28. 4. Zhu GD, Salazar G, Zlatic SA, Fiza B, Doucette MM, Heilman CJ, Levey AI, Faundez V, L'hernault SW.Mol Biol Cell. 2009 Feb;20(4):1223-1240. Epub 2008 Dec 24.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ras-related protein Rab-7b isoform a
NCBI Official Synonym Full Names
RAB7B, member RAS oncogene family
NCBI Official Symbol
RAB7B
NCBI Official Synonym Symbols
RAB7
NCBI Protein Information
ras-related protein Rab-7b
UniProt Protein Name
Ras-related protein Rab-7b
UniProt Gene Name
RAB7B
UniProt Entry Name
RAB7B_HUMAN
Similar Products
Product Notes
The RAB7B rab7b (Catalog #AAA24333) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB7B (Ras-related Protein Rab-7b, RAB7) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB7B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB7B rab7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB7B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.