Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA14798_WB6.jpg WB (Western Blot) (RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in A-431.)

Mouse anti-Human RAB7B Monoclonal Antibody | anti-RAB7B antibody

RAB7B (Ras-related Protein Rab-7b, RAB7)

Average rating 0.0
No ratings yet
Gene Names
RAB7B; RAB7
Reactivity
Human
Applications
ELISA, Western Blot, Immunoprecipitation
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RAB7B, Antibody; RAB7B (Ras-related Protein Rab-7b, RAB7); Anti -RAB7B (Ras-related Protein Rab-7b, RAB7); anti-RAB7B antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B3
Specificity
Recognizes human RAB7B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC*
Applicable Applications for anti-RAB7B antibody
ELISA, WB (Western Blot), IP (Immunoprecipitation)
Application Notes
Suitable for use in ELISA, Western Blot and Immunoprecipitation.
Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.
Immunogen
Partial recombinant protein corresponding to aa100-200 from human RAB7B (NP_796377) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in A-431.)

product-image-AAA14798_WB6.jpg WB (Western Blot) (RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in A-431.)

Application Data

(Detection limit for recombinant GST tagged RAB7B is ~0.03ng/ml as a capture antibody.)

product-image-AAA14798_APP5.jpg Application Data (Detection limit for recombinant GST tagged RAB7B is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of RAB7B transfected lysate using RAB7B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB7B rabbit polyclonal antibody.)

product-image-AAA14798_IP4.jpg IP (Immunoprecipitation) (Immunoprecipitation of RAB7B transfected lysate using RAB7B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB7B rabbit polyclonal antibody.)

WB (Western Blot)

(Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody.Lane 1: RAB7B transfected lysate (22.5kD).Lane 2: Non-transfected lysate.)

product-image-AAA14798_WB3.jpg WB (Western Blot) (Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody.Lane 1: RAB7B transfected lysate (22.5kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in human kidney.)

product-image-AAA14798_WB2.jpg WB (Western Blot) (RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in human kidney.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

product-image-AAA14798_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-RAB7B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,511 Da
NCBI Official Full Name
ras-related protein Rab-7b
NCBI Official Synonym Full Names
RAB7B, member RAS oncogene family
NCBI Official Symbol
RAB7B
NCBI Official Synonym Symbols
RAB7
NCBI Protein Information
ras-related protein Rab-7b; Ras-related protein Rab-7
UniProt Protein Name
Ras-related protein Rab-7b
UniProt Gene Name
RAB7B
UniProt Entry Name
RAB7B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RAB7B rab7b (Catalog #AAA14798) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB7B (Ras-related Protein Rab-7b, RAB7) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB7B can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot), IP (Immunoprecipitation). Suitable for use in ELISA, Western Blot and Immunoprecipitation. Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Researchers should empirically determine the suitability of the RAB7B rab7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DIWRGDVLAK IVPMEQSYPM VLLGNKIDLA DRKVPQEVAQ GWCREKDIPY FEVSAKNDIN VVQAFEMLAS RALSRYQSIL ENHLTESIKL SPDQSRSRCC *. It is sometimes possible for the material contained within the vial of "RAB7B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.