Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA126927_FACS8.jpg FCM/FACS (Flow Cytometry) (Figure 5. Flow Cytometry analysis of Jurkat cells using anti-RAGE/AGER antibody (AAA126927).Overlay histogram showing Jurkat cells stained with AAA126927 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-RAGE/AGER Antibody (AAA126927, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse RAGE/AGER Monoclonal Antibody | anti-AGER antibody

Anti-RAGE/AGER Antibody Picoband (monoclonal, 5C6C1)

Gene Names
AGER; RAGE
Reactivity
Human, Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
RAGE/AGER, Antibody; Anti-RAGE/AGER Antibody Picoband (monoclonal, 5C6C1); anti-AGER antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b
Clone Number
5C6C1
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-AGER antibody
FCM/FACS (Flow Cytometry), IHC (Immunohistochemistry), WB (Western Blot)
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids.
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 5. Flow Cytometry analysis of Jurkat cells using anti-RAGE/AGER antibody (AAA126927).Overlay histogram showing Jurkat cells stained with AAA126927 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-RAGE/AGER Antibody (AAA126927, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126927_FACS8.jpg FCM/FACS (Flow Cytometry) (Figure 5. Flow Cytometry analysis of Jurkat cells using anti-RAGE/AGER antibody (AAA126927).Overlay histogram showing Jurkat cells stained with AAA126927 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-RAGE/AGER Antibody (AAA126927, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody (AAA126927).RAGE/AGER was detected in a paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-RAGE/AGER Antibody (AAA126927) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA126927_IHC10.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody (AAA126927).RAGE/AGER was detected in a paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-RAGE/AGER Antibody (AAA126927) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemisry)

(Figure 3. IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody (AAA126927).RAGE/AGER was detected in a paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-RAGE/AGER Antibody (AAA126927) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA126927_IHC11.jpg IHC (Immunohistochemisry) (Figure 3. IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody (AAA126927).RAGE/AGER was detected in a paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-RAGE/AGER Antibody (AAA126927) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody (AAA126927).RAGE/AGER was detected in a paraffin-embedded section of mouse lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-RAGE/AGER Antibody (AAA126927) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA126927_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody (AAA126927).RAGE/AGER was detected in a paraffin-embedded section of mouse lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-RAGE/AGER Antibody (AAA126927) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of RAGE/AGER using anti-RAGE/AGER antibody (AAA126927).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: rat lung tissue lysates,Lane 2: mouse lung tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-RAGE/AGER antigen affinity purified monoclonal antibody (#AAA126927) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for RAGE/AGER at approximately 43 kDa. The expected band size for RAGE/AGER is at 43 kDa.)

product-image-AAA126927_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of RAGE/AGER using anti-RAGE/AGER antibody (AAA126927).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: rat lung tissue lysates,Lane 2: mouse lung tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-RAGE/AGER antigen affinity purified monoclonal antibody (#AAA126927) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for RAGE/AGER at approximately 43 kDa. The expected band size for RAGE/AGER is at 43 kDa.)
Related Product Information for anti-AGER antibody
The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.
Product Categories/Family for anti-AGER antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
177
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,803 Da
NCBI Official Full Name
advanced glycosylation end product-specific receptor isoform 6
NCBI Official Synonym Full Names
advanced glycosylation end product-specific receptor
NCBI Official Symbol
AGER
NCBI Official Synonym Symbols
RAGE
NCBI Protein Information
advanced glycosylation end product-specific receptor; RAGE isoform sRAGE-delta; RAGE isoform NtRAGE-delta
UniProt Protein Name
Advanced glycosylation end product-specific receptor
UniProt Gene Name
AGER
UniProt Synonym Gene Names
RAGE
UniProt Entry Name
RAGE_HUMAN

Similar Products

Product Notes

The AGER ager (Catalog #AAA126927) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-RAGE/AGER Antibody Picoband (monoclonal, 5C6C1) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAGE/AGER can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the AGER ager for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAGE/AGER, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.