Loading...

Skip to main content
WB (Western Blot) (Western Blot detection against Immunogen (37kD) .)

Mouse anti-Human, Mouse RBM9 Monoclonal Antibody | anti-RBFOX2 antibody

RBM9 (RNA Binding Motif Protein 9, RNA Binding Protein 9, Hexaribonucleotide Binding Protein 2, HRNBP2, Repressor of Tamoxifen Transcriptional Activity, RTA)

Reactivity
Human, Mouse
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RBM9, Antibody; RBM9 (RNA Binding Motif Protein 9, RNA Binding Protein 9, Hexaribonucleotide Binding Protein 2, HRNBP2, Repressor of Tamoxifen Transcriptional Activity, RTA); Anti -RBM9 (RNA Binding Motif Protein 9, RNA Binding Protein 9, Hexaribonucleotide Binding Protein 2, HRNBP2, Repressor of Tamoxifen Transcriptional Activity, RTA); anti-RBFOX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G3
Specificity
Recognizes human RBM9. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS
Applicable Applications for anti-RBFOX2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa1-100 from RBM9 (AAH13115) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (37kD) .)

WB (Western Blot) (Western Blot detection against Immunogen (37kD) .)

WB (Western Blot)

(RBM9 monoclonal antibody Western Blot analysis of RBM9 expression in NIH/3T3.)

WB (Western Blot) (RBM9 monoclonal antibody Western Blot analysis of RBM9 expression in NIH/3T3.)

WB (Western Blot)

(Western blot analysis of RBM9 over-expressed 293 cell line, cotransfected with RBM9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM9 monoclonal antibody.)

WB (Western Blot) (Western blot analysis of RBM9 over-expressed 293 cell line, cotransfected with RBM9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM9 monoclonal antibody.)

Application Data

(Detection limit for recombinant GST tagged RBM9 is ~0.1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged RBM9 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell. [antibody concentration 10ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibodyLane 1: RBM9 transfected lysate (40.4kD).Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibodyLane 1: RBM9 transfected lysate (40.4kD).Lane 2: Non-transfected lysate.)
Related Product Information for anti-RBFOX2 antibody
This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-RBFOX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
41,374 Da
NCBI Official Full Name
RBM9
UniProt Protein Name
RNA binding protein fox-1 homolog 2
UniProt Gene Name
RBFOX2
UniProt Synonym Gene Names
FOX2; HRNBP2; RBM9; RTA
UniProt Entry Name
RFOX2_HUMAN

Similar Products

Product Notes

The RBM9 rbfox2 (Catalog #AAA14778) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBM9 (RNA Binding Motif Protein 9, RNA Binding Protein 9, Hexaribonucleotide Binding Protein 2, HRNBP2, Repressor of Tamoxifen Transcriptional Activity, RTA) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RBM9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the RBM9 rbfox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEKKKMVTQG NQEPTTTPDA MVQPFTTIPF PPPPQNGIPT EYGVPHTQDY AGQTGEHNLT LYGSTQAHGE QSSNSPSTQN GSLTTEGGAQ TDGQQSQTQS. It is sometimes possible for the material contained within the vial of "RBM9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.