Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282811_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug RING1A antibody (AAA282811). Western blot was performed from the immunoprecipitate using RING1A antibody (AAA282811) at a dilution of 1:1000.)

Rabbit anti-Human RING1A Monoclonal Antibody | anti-RING1 antibody

RING1A Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
RING1A, Antibody; RING1A Rabbit mAb; RNF1; RING1A; anti-RING1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
DPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAP
Applicable Applications for anti-RING1 antibody
ELISA, IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RING1A A (Q06587).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug RING1A antibody (AAA282811). Western blot was performed from the immunoprecipitate using RING1A antibody (AAA282811) at a dilution of 1:1000.)

product-image-AAA282811_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug RING1A antibody (AAA282811). Western blot was performed from the immunoprecipitate using RING1A antibody (AAA282811) at a dilution of 1:1000.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using RING1A Rabbit mAb (AAA282811) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA282811_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using RING1A Rabbit mAb (AAA282811) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using RING1A Rabbit mAb (AAA282811) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA282811_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using RING1A Rabbit mAb (AAA282811) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-RING1 antibody
This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 42kDa
Observed MW: 54kDa
UniProt Protein Name
E3 ubiquitin-protein ligase RING1
UniProt Gene Name
RING1
UniProt Synonym Gene Names
RNF1
UniProt Entry Name
RING1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RING1 ring1 (Catalog #AAA282811) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RING1A Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RING1A can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RING1 ring1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DPNFDALISK IYPSREEYEA HQDRVLIRLS RLHNQQALSS SIEEGLRMQA MHRAQRVRRP IPGSDQTTTM SGGEGEPGEG EGDGEDVSSD SAPDSAPGPA P. It is sometimes possible for the material contained within the vial of "RING1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.