Mouse RNF2 Monoclonal Antibody | anti-RNF2 antibody

RNF2 Mouse Monoclonal Antibody

Cat. Num. AAA330104

• Reactivity: Human, Mouse, Rat; Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
• Applications: Western Blot
• Purity: Affinity-chromatography.
• Synonyms: RNF2, Antibody; RNF2 Mouse Monoclonal Antibody; BAP 1; BAP1; DING; DinG protein; E3 ubiquitin protein ligase RING 2; E3 ubiquitin protein ligase RING2; E3 ubiquitin-protein ligase RING2; HIP2 interacting protein 3; HIP2-interacting protein 3; HIPI 3; HIPI3; Huntingtin interacting protein 2 interacting protein 3; Huntingtin-interacting protein 2-interacting protein 3; OTTHUMP00000060668; Polycomb M33 interacting protein Ring 1B; Polycomb M33 interacting protein Ring1B; Protein DinG; RING 1B; RING 2; RING finger protein 1B; RING finger protein 2; RING finger protein BAP 1; RING finger protein BAP-1; RING finger protein BAP1; RING1b; RING2_HUMAN; RNF 2; Rnf2; anti-RNF2 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat; Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
• Clonality: Monoclonal
• Isotype: Mouse IgG1
• Specificity: RNF2 Antibody detects endogenous levels of total RNF2.
• Purity/Purification: Affinity-chromatography.
• Form/Format: Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Sequence: MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK

• Applicable Applications for anti-RNF2 antibody: WB (Western Blot)
• Immunogen: A synthesized peptide derived from human RNF2(Accession Q99496), corresponding to amino acid residues T184-G204.
• Conjugation: Unconjugated
• Preparation and Storage: Store at -20 degree C. Stable for 12 months from date of receipt.

WB (Western Blot)

(Western blot analysis of extracts from various samples, using RNF2 Mouse Monoclonal Antibody. Lane 1: HepG2 cells treated with blocking-peptides, Lane 2: HepG2 cells, Lane 3: A2780 cells, Lane 4: Hela cells.)

WB (Western Blot)

(Western blot analysis of extracts from MCF7 cells, using RNF2 Mouse Monoclonal Antibody. The lane on the left was treated with blocking-peptides.)

Related Product Information for anti-RNF2 antibody

Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.

Product Categories/Family for anti-RNF2 antibody

Primary antibodies

NCBI and Uniprot Product Information

• NCBI GeneID: 6045
• UniProt Accession #: Q99496
• Molecular Weight: 37kD; 38kD(Calculated)