Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RPL19 on HeLa cell. [antibody concentration 10ug/ml])

Mouse RPL19 Monoclonal Antibody | anti-RPL19 antibody

RPL19 (60S Ribosomal Protein L19, DKFZp779D216, FLJ27452, HGNC:10312, MGC71997) (HRP)

Gene Names
RPL19; L19
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RPL19; Monoclonal Antibody; RPL19 (60S Ribosomal Protein L19; DKFZp779D216; FLJ27452; HGNC:10312; MGC71997) (HRP); anti-RPL19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
3H4
Specificity
Recognizes human RPL19. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RPL19 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1-10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human RPL19 (NP_000972) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMR
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RPL19 on HeLa cell. [antibody concentration 10ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RPL19 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistchemistry)

(Immunoperoxidase of monoclonal antibody to RPL19 on formalin-fixed paraffin-embedded human small Intestine tissue. [antibody concentration 1~10ug/ml])

IHC (Immunohistchemistry) (Immunoperoxidase of monoclonal antibody to RPL19 on formalin-fixed paraffin-embedded human small Intestine tissue. [antibody concentration 1~10ug/ml])

WB (Western Blot)

(RPL19 monoclonal antibody. Western Blot analysis of RPL19 expression in NIH/3T3.)

WB (Western Blot) (RPL19 monoclonal antibody. Western Blot analysis of RPL19 expression in NIH/3T3.)

WB (Western Blot)

(RPL19 monoclonal antibody. Western Blot analysis of RPL19 expression in Jurkat.)

WB (Western Blot) (RPL19 monoclonal antibody. Western Blot analysis of RPL19 expression in Jurkat.)

WB (Western Blot)

(RPL19 monoclonal antibody. Western Blot analysis of RPL19 expression in Raw 264.7.)

WB (Western Blot) (RPL19 monoclonal antibody. Western Blot analysis of RPL19 expression in Raw 264.7.)

WB (Western Blot)

(RPL19 monoclonal antibody. Western Blot analysis of RPL19 expression in PC-12.)

WB (Western Blot) (RPL19 monoclonal antibody. Western Blot analysis of RPL19 expression in PC-12.)

WB (Western Blot)

(RPL19 monoclonal antibody. Western Blot analysis of RPL19 expression in HeLa.)

WB (Western Blot) (RPL19 monoclonal antibody. Western Blot analysis of RPL19 expression in HeLa.)
Product Categories/Family for anti-RPL19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
60S ribosomal protein L19 isoform 1
NCBI Official Synonym Full Names
ribosomal protein L19
NCBI Official Symbol
RPL19
NCBI Official Synonym Symbols
L19
NCBI Protein Information
60S ribosomal protein L19
UniProt Protein Name
60S ribosomal protein L19
UniProt Gene Name
RPL19
UniProt Entry Name
RL19_HUMAN

Similar Products

Product Notes

The RPL19 rpl19 (Catalog #AAA25523) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPL19 (60S Ribosomal Protein L19, DKFZp779D216, FLJ27452, HGNC:10312, MGC71997) (HRP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPL19 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1-10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPL19 rpl19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPL19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.