Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (RRAS2 monoclonal antibody Western Blot analysis of RRAS2 expression in A-431.)

Mouse RRAS2 Monoclonal Antibody | anti-RRAS2 antibody

RRAS2 (Ras-related Protein R-Ras2, Ras-like Protein TC21, Teratocarcinoma Oncogene, TC21) (HRP)

Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RRAS2; Monoclonal Antibody; RRAS2 (Ras-related Protein R-Ras2; Ras-like Protein TC21; Teratocarcinoma Oncogene; TC21) (HRP); anti-RRAS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D3-4B8
Specificity
Recognizes human RRAS2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RRAS2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-205 from RRAS2 (AAH13106) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(RRAS2 monoclonal antibody Western Blot analysis of RRAS2 expression in A-431.)

WB (Western Blot) (RRAS2 monoclonal antibody Western Blot analysis of RRAS2 expression in A-431.)

WB (Western Blot)

(RRAS2 monoclonal antibody Western Blot analysis of RRAS2 expression in NIH/3T3)

WB (Western Blot) (RRAS2 monoclonal antibody Western Blot analysis of RRAS2 expression in NIH/3T3)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RRAS2 on A-431 cell. [antibody concentration 10ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RRAS2 on A-431 cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. [antibody concentration 5ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. [antibody concentration 5ug/ml])

WB (Western Blot)

(Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody Lane 1: RRAS2 transfected lysate (Predicted MW: 23.4kD. Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody Lane 1: RRAS2 transfected lysate (Predicted MW: 23.4kD. Lane 2: Non-transfected lysate.)

WB (Western Blot)

(RRAS2 monoclonal antibody Western Blot analysis of RRAS2 expression in HeLa.)

WB (Western Blot) (RRAS2 monoclonal antibody Western Blot analysis of RRAS2 expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (48.55kD).)

WB (Western Blot) (Western Blot detection against Immunogen (48.55kD).)
Product Categories/Family for anti-RRAS2 antibody
References
1. In Vivo Regulation of TGF-?] by R-Ras2 Revealed through Loss of the RasGAP Protein NF1. Patmore DM, Welch S, Fulkerson PC, Wu J, Choi K, Eaves D, Kordich JJ, Collins MH, Cripe TP, Ratner N.Cancer Res. 2012 Oct 15;72(20):5317-27. doi: 10.1158/0008- 5472.CAN-12-1972. Epub 2012 Aug 23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
24,196 Da
NCBI Official Full Name
Homo sapiens related RAS viral (r-ras) oncogene homolog 2, mRNA

Similar Products

Product Notes

The RRAS2 (Catalog #AAA25528) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RRAS2 (Ras-related Protein R-Ras2, Ras-like Protein TC21, Teratocarcinoma Oncogene, TC21) (HRP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RRAS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RRAS2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RRAS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.