Loading...

Skip to main content

Mouse anti-Human, Mouse S100A4 Monoclonal Antibody | anti-S100A4 antibody

S100A4 (Protein S100-A4, Calvasculin, Metastasin, Placental Calcium-binding Protein, Protein Mts1, S100 Calcium-binding Protein A4, CAPL, MTS1) (AP)

Gene Names
S100A4; 42A; 18A2; CAPL; FSP1; MTS1; P9KA; PEL98
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
S100A4, Antibody; S100A4 (Protein S100-A4, Calvasculin, Metastasin, Placental Calcium-binding Protein, Protein Mts1, S100 Calcium-binding Protein A4, CAPL, MTS1) (AP); anti-S100A4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F12-1G7
Specificity
Recognizes human S100A4. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-S100A4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-102 from human S100A4 (AAH16300) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-S100A4 antibody
References
1. Potential role for S100A4 in the disruption of the blood-brain barrier in collagen-induced arthritic mice, an animal model of rheumatoid arthritis. Nishioku T, Furusho K, Tomita A, Ohishi H, Dohgu S, Shuto H, Yamauchi A, Kataoka Y.Neuroscience. 2011 May 26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
11,729 Da
NCBI Official Full Name
Homo sapiens S100 calcium binding protein A4, mRNA
NCBI Official Synonym Full Names
S100 calcium binding protein A4
NCBI Official Symbol
S100A4
NCBI Official Synonym Symbols
42A; 18A2; CAPL; FSP1; MTS1; P9KA; PEL98
NCBI Protein Information
protein S100-A4

Similar Products

Product Notes

The S100A4 (Catalog #AAA24350) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The S100A4 (Protein S100-A4, Calvasculin, Metastasin, Placental Calcium-binding Protein, Protein Mts1, S100 Calcium-binding Protein A4, CAPL, MTS1) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's S100A4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the S100A4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "S100A4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.