Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24354_WB6.jpg WB (Western Blot) (SCARA3 monoclonal antibody, Western Blot analysis of SCARA3 expression in IMR-32.)

Mouse SCARA3 Monoclonal Antibody | anti-SCARA3 antibody

SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1) (AP)

Average rating 0.0
No ratings yet
Gene Names
SCARA3; CSR; APC7; CSR1; MSLR1; MSRL1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCARA3, Antibody; SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1) (AP); anti-SCARA3 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A2
Specificity
Recognizes human SCARA3. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SCARA3 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa316-416 from human SCARA3 (NP_057324) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(SCARA3 monoclonal antibody, Western Blot analysis of SCARA3 expression in IMR-32.)

product-image-AAA24354_WB6.jpg WB (Western Blot) (SCARA3 monoclonal antibody, Western Blot analysis of SCARA3 expression in IMR-32.)

Application Data

(Detection limit for recombinant GST tagged SCARA3 is ~3ng/ml as a capture antibody.)

product-image-AAA24354_APP5.jpg Application Data (Detection limit for recombinant GST tagged SCARA3 is ~3ng/ml as a capture antibody.)

WB (Western Blot)

(SCARA3 monoclonal antibody, Western Blot analysis of SCARA3 expression in NIH/3T3.)

product-image-AAA24354_WB4.jpg WB (Western Blot) (SCARA3 monoclonal antibody, Western Blot analysis of SCARA3 expression in NIH/3T3.)

WB (Western Blot)

(SCARA3 monoclonal antibody. Western Blot analysis of SCARA3 expression in HepG2.)

product-image-AAA24354_WB3.jpg WB (Western Blot) (SCARA3 monoclonal antibody. Western Blot analysis of SCARA3 expression in HepG2.)

WB (Western Blot)

(SCARA3 monoclonal antibody. Western Blot analysis of SCARA3 expression in PC-12.)

product-image-AAA24354_WB2.jpg WB (Western Blot) (SCARA3 monoclonal antibody. Western Blot analysis of SCARA3 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

product-image-AAA24354_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-SCARA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,434 Da
NCBI Official Full Name
scavenger receptor class A member 3 isoform 1
NCBI Official Synonym Full Names
scavenger receptor class A, member 3
NCBI Official Symbol
SCARA3
NCBI Official Synonym Symbols
CSR; APC7; CSR1; MSLR1; MSRL1
NCBI Protein Information
scavenger receptor class A member 3; cellular stress response gene protein; cellular stress response protein; macrophage scavenger receptor-like 1
UniProt Protein Name
Scavenger receptor class A member 3
UniProt Gene Name
SCARA3
UniProt Synonym Gene Names
CSR
UniProt Entry Name
SCAR3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SCARA3 scara3 (Catalog #AAA24354) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SCARA3 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCARA3 scara3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCARA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.