Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24651_APP7.jpg Application Data (Detection limit for recombinant GST tagged SDCBP is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human SDCBP Monoclonal Antibody | anti-SDCBP antibody

SDCBP (Syndecan-binding Protein 1, Melanoma Differentiation-associated Protein 9, MDA9, MDA-9, Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18, TACIP18, Scaffold Protein Pbp1, SYCL, Syntenin-1, ST1) APC

Gene Names
SDCBP; ST1; MDA9; SYCL; MDA-9; TACIP18
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SDCBP, Antibody; SDCBP (Syndecan-binding Protein 1, Melanoma Differentiation-associated Protein 9, MDA9, MDA-9, Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18, TACIP18, Scaffold Protein Pbp1, SYCL, Syntenin-1, ST1) APC; anti-SDCBP antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C12
Specificity
Recognizes human SDCBP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SDCBP antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot)
Application Notes
IF: 35ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human SDCBP (NP_005616) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged SDCBP is ~0.03ng/ml as a capture antibody.)

product-image-AAA24651_APP7.jpg Application Data (Detection limit for recombinant GST tagged SDCBP is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of SDCBP transfected lysate using SDCBP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SDCBP rabbit polyclonal antibody.)

product-image-AAA24651_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation of SDCBP transfected lysate using SDCBP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SDCBP rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SDCBP on HepG2 cell. [antibody concentration 35ug/ml].)

product-image-AAA24651_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SDCBP on HepG2 cell. [antibody concentration 35ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SDCBP on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

product-image-AAA24651_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SDCBP on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of SDCBP expression in transfected 293T cell line by SDCBP monoclonal antibody. Lane 1: SDCBP transfected lysate (32.4kD). Lane 2: Non-transfected lysate.)

product-image-AAA24651_WB3.jpg WB (Western Blot) (Western Blot analysis of SDCBP expression in transfected 293T cell line by SDCBP monoclonal antibody. Lane 1: SDCBP transfected lysate (32.4kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SDCBP monoclonal antibody, Western Blot analysis of SDCBP expression in HepG2.)

product-image-AAA24651_WB2.jpg WB (Western Blot) (SDCBP monoclonal antibody, Western Blot analysis of SDCBP expression in HepG2.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

product-image-AAA24651_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-SDCBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.6kDa (318aa), confirmed by MALDI-TOF
NCBI Official Full Name
syntenin-1 isoform 1
NCBI Official Synonym Full Names
syndecan binding protein
NCBI Official Symbol
SDCBP
NCBI Official Synonym Symbols
ST1; MDA9; SYCL; MDA-9; TACIP18
NCBI Protein Information
syntenin-1
UniProt Protein Name
Syntenin-1
UniProt Gene Name
SDCBP
UniProt Synonym Gene Names
MDA9; SYCL; MDA-9; TACIP18
UniProt Entry Name
SDCB1_HUMAN

Similar Products

Product Notes

The SDCBP sdcbp (Catalog #AAA24651) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SDCBP (Syndecan-binding Protein 1, Melanoma Differentiation-associated Protein 9, MDA9, MDA-9, Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18, TACIP18, Scaffold Protein Pbp1, SYCL, Syntenin-1, ST1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SDCBP can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot). IF: 35ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SDCBP sdcbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SDCBP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.