Mouse anti-Human SHC Monoclonal Antibody | anti-SHC antibody

SHC (SHC-transforming Protein 1, SH2 Domain Protein C1, SHC1, SHC-transforming Protein 3, SHC-transforming Protein A, SHCA, Src Homology 2 Domain-containing-transforming Protein C1, FLJ26504) (Biotin)

Cat. Num. AAA24950

• Gene Names: SHC1; SHC; SHCA
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SHC, Antibody; SHC (SHC-transforming Protein 1, SH2 Domain Protein C1, SHC1, SHC-transforming Protein 3, SHC-transforming Protein A, SHCA, Src Homology 2 Domain-containing-transforming Protein C1, FLJ26504) (Biotin); anti-SHC antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 3F4
• Specificity: Recognizes human SHC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 2899

• Applicable Applications for anti-SHC antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa171-280 from human SHC1 (AAH33925) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PIK3R1 and SHC1 Huh7 cells were stained with PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PIK3R1 and SHC1 HeLa cells were stained with PIK3R1 rabbit purified polyclonal 1:1200 and SHC1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Detection limit for recombinant GST tagged SHC1 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SHC1 on A-431 cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SHC1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1ug/ml].)

WB (Western Blot)

(SHC1 monoclonal antibody, Western Blot analysis of SHC1 expression in A-431.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.1kD).)

Product Categories/Family for anti-SHC antibody

Antibodies; Adapter Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21706899
• NCBI GeneID: 6464
• NCBI Official Full Name: Homo sapiens SHC (Src homology 2 domain containing) transforming protein 1, mRNA
• NCBI Official Synonym Full Names: SHC adaptor protein 1
• NCBI Official Symbol: SHC1
• NCBI Official Synonym Symbols: SHC; SHCA
• NCBI Protein Information: SHC-transforming protein 1