Mouse SHP2/PTPN11 Monoclonal Antibody | anti-SHP2 antibody
Anti-SHP2/PTPN11 Antibody (monoclonal, 2E6)
Gene Names
PTPN11; CFC; NS1; JMML; SHP2; BPTP3; PTP2C; METCDS; PTP-1D; SH-PTP2; SH-PTP3
Reactivity
Human, Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Immunofluorescence, Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SHP2/PTPN11, Antibody; Anti-SHP2/PTPN11 Antibody (monoclonal, 2E6); Tyrosine-protein phosphatase non-receptor type 11; Protein-tyrosine phosphatase 1D; PTP-1D; Protein-tyrosine phosphatase 2C; PTP-2C; SH-PTP2; SHP-2; Shp2; SH-PTP3; PTPN11; PTP2C; SHPTP2; Protein tyrosine phosphatase, non-receptor type 11; anti-SHP2 antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b
Clone Number
2E6
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized; Each vial contains 4mg Trehalose, 0.9mg NaCI, 0.2mg Na2HPO4, 0.05mg NaN3
Sequence Length
593
Applicable Applications for anti-SHP2 antibody
FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC-P and ICC.
Preparation and Storage
Store at -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.
Avoid repeated freezing and thawing.
Avoid repeated freezing and thawing.
Related Product Information for anti-SHP2 antibody
Description: Mouse IgG monoclonal antibody for SHP2/PTPN11 detection. Tested with WB, IHC-P, IHC-F, ICC/IF in Human; Mouse; Rat.
Background: PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1, 779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
Background: PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1, 779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
References
1. Higashi, H., Tsutsumi, R., Muto, S., Sugiyama, T., Azuma, T, Asaka, M., Hatakeyama, M. SHP-2 tyrosine phosphatase as an intracellular target of Helicobacter pylori CagA protein. Science 295: 683-686, 2002.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 11 isoform 3
NCBI Official Synonym Full Names
protein tyrosine phosphatase, non-receptor type 11
NCBI Official Symbol
PTPN11
NCBI Official Synonym Symbols
CFC; NS1; JMML; SHP2; BPTP3; PTP2C; METCDS; PTP-1D; SH-PTP2; SH-PTP3
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 11
UniProt Protein Name
Tyrosine-protein phosphatase non-receptor type 11
UniProt Gene Name
PTPN11
UniProt Synonym Gene Names
PTP2C; SHPTP2; PTP-1D; PTP-2C; SHP-2; Shp2
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The SHP2 ptpn11 (Catalog #AAA125128) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-SHP2/PTPN11 Antibody (monoclonal, 2E6) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SHP2/PTPN11 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SHP2 ptpn11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SHP2/PTPN11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.