Rabbit anti-Human Smad2 Monoclonal Antibody | anti-SMAD2 antibody

[KD Validated] Smad2 Rabbit mAb

Cat. Num. AAA28489

• Reactivity: Human
• Applications: Western Blot, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
• Purity: Affinity purification
• Synonyms: Smad2, Antibody; [KD Validated] Smad2 Rabbit mAb; JV18; LDS6; CHTD8; MADH2; MADR2; JV18-1; hMAD-2; hSMAD2; [KD Validated] Smad2; anti-SMAD2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTG

• Applicable Applications for anti-SMAD2 antibody: Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA)
• Application Notes: WB: 1:1000-1:2000; IF/ICC: 1:100-1:400; IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Smad2 (Q15796).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug Smad2 antibody (AAA28489). Western blot was performed from the immunoprecipitate using Smad2 antibody (AAA28489) at a dilution of 1:1000.)

ICC (Immunocytochemistry)

(Confocal imaging of HeLa cells using [KD Validated] Smad2 Rabbit mAb (AAA28489, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using [KD Validated] Smad2 Rabbit mAb (AAA28489) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of lysates from Rat lung, using [KD Validated] Smad2 Rabbit mAb (AAA28489) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

WB (Western Blot)

(Western blot analysis of various lysates using [KD Validated] Smad2 Rabbit mAb (AAA28489) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and Smad2 knockdown (KD) HeLa cells, using [KD Validated] Smad2 Rabbit mAb (AAA28489) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Related Product Information for anti-SMAD2 antibody

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene.

Product Categories/Family for anti-SMAD2 antibody

Epigenetics Nuclear Signaling; Transcription Factors; Protein phosphorylation; Cancer; Signal Transduction; Cell Biology Developmental Biology; Growth factors; TGF-b-Smad Signaling Pathway; ESC Pluripotency and Differentiation; Stem Cells; Cardiovascular;

NCBI and Uniprot Product Information

• NCBI GI #: 51173730
• NCBI GeneID: 4087
• NCBI Accession #: NP_001003652.1
• NCBI GenBank Nucleotide #: NM_001003652.3
• UniProt Accession #: Q15796
• Molecular Weight: Calculated MW: 52kDa; Observed MW: 58kDa
• UniProt Protein Name: Mothers against decapentaplegic homolog 2
• UniProt Gene Name: SMAD2
• UniProt Synonym Gene Names: MADH2; MADR2; MAD homolog 2; Mothers against DPP homolog 2; hMAD-2; SMAD 2; Smad2; hSMAD2
• UniProt Entry Name: SMAD2_HUMAN