Mouse SMAD3 Monoclonal Antibody | anti-SMAD3 antibody

SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (HRP)

Cat. Num. AAA26515

• Gene Names: SMAD3; LDS3; LDS1C; MADH3; JV15-2; HSPC193; HsT17436
• Applications: Western Blot
• Purity: Purified
• Synonyms: SMAD3, Antibody; SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (HRP); SMAD Family Member 3; DKFZp586N0721; DKFZp686J10186; HSPC193; HsT17436; JV15-2; MADH3; MGC60396; anti-SMAD3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1B7
• Specificity: Recognizes SMAD3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SMAD3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SMAD3 (NP_005893, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M07), clone 1B7.Lane 1: SMAD3 transfected lysate (48 KDa).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in Raw 264.7 (Cat # L024V1).)

WB (Western Blot)

(SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in PC-12 (Cat # L012V1).)

WB (Western Blot)

(SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in NIH/3T3 (Cat # L018V1).)

Application Data

(Detection limit for recombinant GST tagged SMAD3 is approximately 3ng/ml as a capture antibody.)

WB (Western Blot)

(SMAD3 monoclonal antibody (M07), clone 1B7 Western Blot analysis of SMAD3 expression in HeLa (Cat # L013V1).)

Product Categories/Family for anti-SMAD3 antibody

Antibodies; Smad Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5174513
• NCBI GeneID: 4088
• NCBI Accession #: NP_005893
• NCBI GenBank Nucleotide #: NM_005902.3
• UniProt Accession #: P84022; O09064; O09144; O14510; O35273; Q92940; Q93002; A8K4B6; B7Z4Z5; B7Z6M9; B7Z9Q2; F5H383
• Molecular Weight: 50.2 kDa (445aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: mothers against decapentaplegic homolog 3 isoform 1
• NCBI Official Synonym Full Names: SMAD family member 3
• NCBI Official Symbol: SMAD3
• NCBI Official Synonym Symbols: LDS3; LDS1C; MADH3; JV15-2; HSPC193; HsT17436
• NCBI Protein Information: mothers against decapentaplegic homolog 3
• UniProt Protein Name: Mothers against decapentaplegic homolog 3
• UniProt Gene Name: SMAD3
• UniProt Synonym Gene Names: MADH3; MAD homolog 3; Mad3; Mothers against DPP homolog 3; hMAD-3; SMAD 3; Smad3; hSMAD3
• UniProt Entry Name: SMAD3_HUMAN