Rabbit anti-Human Smad4 Monoclonal Antibody | anti-SMAD4 antibody

[KO Validated] Smad4 Rabbit mAb

Cat. Num. AAA28490

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, ELISA, Chromatin Immunoprecipitation, Immunoprecipitation
• Purity: Affinity purification
• Synonyms: Smad4, Antibody; [KO Validated] Smad4 Rabbit mAb; JIP; DPC4; MADH4; MYHRS; d4; anti-SMAD4 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: PEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD

• Applicable Applications for anti-SMAD4 antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), ELISA (EIA), Chromatin Immunoprecipitation (ChIP), CUT&Tag
• Application Notes: WB: 1:1000-1:6000; IHC-P: 1:500-1:2000; IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.; ChIP: 5ug antibody for 10ug-15ug of Chromatin; CUT&Tag: 10? cells /1 ug
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 320-552 of human Smad4 (NP_005350.1).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using [KO Validated] Smad4 Rabbit mAb (AAA28490) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug Smad4 antibody (AAA28490). Western blot was performed from the immunoprecipitate using Smad4 antibody (AAA28490) at a dilution of1:1000.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KO Validated] Smad4 Rabbit mAb (AAA28490) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KO Validated] Smad4 Rabbit mAb (AAA28490) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KO Validated] Smad4 Rabbit mAb (AAA28490) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using [KO Validated] Smad4 Rabbit mAb (AAA28490) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and Smad4 knockout (KO) 293T cells using [KO Validated] Smad4 Rabbit mAb (AAA28490) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

WB (Western Blot)

(Western blot analysis of various lysates using [KO Validated] Smad4 Rabbit mAb (AAA28490) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

Application Data

(CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from10? K562 with 1 ug of [KO Validated] Smad4 Rabbit mAb (AAA28490), followed by incubation with Goat Anti-Rabbit IgG(H+L)(AS070).The results denote the enrichment pattern of Smad4 around JUNB gene.)

Application Data

(CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for illumina (RK20265) from 10? K562 cells with 1ug ug of [KO Validated] Smad4 Rabbit mAb (AAA28490), followed by incubation with Goat Anti-Rabbit IgG(H+L)(AS070). The CUT&Tag results denote the enrichment pattern of [KO Validated] Smad4 Rabbit mAb across chromosome 19 (upper panel) and the genomic region encompassing JUNB, a representative gene enriched in [KO Validated] Smad4 Rabbit mAb (lower panel).)

Related Product Information for anti-SMAD4 antibody

This gene encodes a member of the Smad family of signal transduction proteins. Smad proteins are phosphorylated and activated by transmembrane serine-threonine receptor kinases in response to transforming growth factor (TGF)-beta signaling. The product of this gene forms homomeric complexes and heteromeric complexes with other activated Smad proteins, which then accumulate in the nucleus and regulate the transcription of target genes. This protein binds to DNA and recognizes an 8-bp palindromic sequence (GTCTAGAC) called the Smad-binding element (SBE). The protein acts as a tumor suppressor and inhibits epithelial cell proliferation. It may also have an inhibitory effect on tumors by reducing angiogenesis and increasing blood vessel hyperpermeability. The encoded protein is a crucial component of the bone morphogenetic protein signaling pathway. The Smad proteins are subject to complex regulation by post-translational modifications. Mutations or deletions in this gene have been shown to result in pancreatic cancer, juvenile polyposis syndrome, and hereditary hemorrhagic telangiectasia syndrome.

Product Categories/Family for anti-SMAD4 antibody

Epigenetics Nuclear Signaling; Transcription Factors; Cancer; Tumor suppressors; Signal Transduction; MAPK-JNK Signaling Pathway; Cell Biology Developmental Biology; Apoptosis; Cell Cycle; Cell Cycle Control-G1 S Checkpoint; TGF-b-Smad Signaling Pathway;

NCBI and Uniprot Product Information

• NCBI GI #: 4885457
• NCBI GeneID: 4089
• NCBI Accession #: NP_005350.1
• NCBI GenBank Nucleotide #: NM_005359.5
• UniProt Accession #: Q13485; A8K405
• Molecular Weight: Calculated MW: 60kDa; Observed MW: 70kDa/
• UniProt Protein Name: Mothers against decapentaplegic homolog 4
• UniProt Gene Name: SMAD4
• UniProt Synonym Gene Names: DPC4; MADH4; MAD homolog 4; Mothers against DPP homolog 4; SMAD 4; Smad4; hSMAD4
• UniProt Entry Name: SMAD4_HUMAN