Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24667_APP7.jpg Application Data (Detection limit for recombinant GST tagged SORD is ~0.1ng/ml as a capture antibody.)

Mouse SORD Monoclonal Antibody | anti-SORD antibody

SORD (Sorbitol Dehydrogenase, L-iditol 2-dehydrogenase) APC

Average rating 0.0
No ratings yet
Gene Names
SORD; SORD1; HEL-S-95n
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SORD, Antibody; SORD (Sorbitol Dehydrogenase, L-iditol 2-dehydrogenase) APC; anti-SORD antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D3
Specificity
Recognizes human SORD. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SORD antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 1.2ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from human SORD (NP_003095) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGR*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged SORD is ~0.1ng/ml as a capture antibody.)

product-image-AAA24667_APP7.jpg Application Data (Detection limit for recombinant GST tagged SORD is ~0.1ng/ml as a capture antibody.)

IHC (Immunohistchemistry)

(Immunoperoxidase of monoclonal antibody to SORD on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.2ug/ml].)

product-image-AAA24667_IHC6.jpg IHC (Immunohistchemistry) (Immunoperoxidase of monoclonal antibody to SORD on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.2ug/ml].)

WB (Western Blot)

(Western Blot analysis of SORD expression in transfected 293T cell line by SORD monoclonal antibody. Lane 1: SORD transfected lysate (38.165kD). Lane 2: Non-transfected lysate.)

product-image-AAA24667_WB5.jpg WB (Western Blot) (Western Blot analysis of SORD expression in transfected 293T cell line by SORD monoclonal antibody. Lane 1: SORD transfected lysate (38.165kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SORD monoclonal antibody. Western Blot analysis of SORD expression in Raw 264.7.)

product-image-AAA24667_WB4.jpg WB (Western Blot) (SORD monoclonal antibody. Western Blot analysis of SORD expression in Raw 264.7.)

WB (Western Blot)

(SORD monoclonal antibody, Western Blot analysis of SORD expression in Hela NE.)

product-image-AAA24667_WB3.jpg WB (Western Blot) (SORD monoclonal antibody, Western Blot analysis of SORD expression in Hela NE.)

WB (Western Blot)

(SORD monoclonal antibody. Western Blot analysis of SORD expression in PC-12.)

product-image-AAA24667_WB2.jpg WB (Western Blot) (SORD monoclonal antibody. Western Blot analysis of SORD expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.21kD).)

product-image-AAA24667_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (38.21kD).)
Product Categories/Family for anti-SORD antibody
References
1. Sorbitol dehydrogenase expression is regulated by androgens in the human prostate. Szabo Z, Hamalainen J, Loikkanen I, Moilanen AM, Hirvikoski P, Vaisanen T, Paavonen TK, Vaarala MH.Oncol Rep. 2010 May;23(5):1233-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
sorbitol dehydrogenase
NCBI Official Synonym Full Names
sorbitol dehydrogenase
NCBI Official Symbol
SORD
NCBI Official Synonym Symbols
SORD1; HEL-S-95n
NCBI Protein Information
sorbitol dehydrogenase
UniProt Protein Name
Sorbitol dehydrogenase
UniProt Gene Name
SORD
UniProt Entry Name
DHSO_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SORD sord (Catalog #AAA24667) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SORD (Sorbitol Dehydrogenase, L-iditol 2-dehydrogenase) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SORD can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 1.2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SORD sord for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SORD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.