Loading...

Skip to main content
IP (Immunoprecipitation) (Immunoprecipitation of SOX9 transfected lysate using SOX9 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SOX9 rabbit polyclonal antibody.)

Mouse anti-Human SOX9 Monoclonal Antibody | anti-SOX9 antibody

SOX9 (Transcription Factor SOX-9, SOX 9) (FITC)

Gene Names
SOX9; CMD1; SRA1; CMPD1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SOX9, Antibody; SOX9 (Transcription Factor SOX-9, SOX 9) (FITC); anti-SOX9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C10
Specificity
Recognizes human SOX9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SOX9 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa400-510 from human SOX9 (NP_000337) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IP (Immunoprecipitation)

(Immunoprecipitation of SOX9 transfected lysate using SOX9 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SOX9 rabbit polyclonal antibody.)

IP (Immunoprecipitation) (Immunoprecipitation of SOX9 transfected lysate using SOX9 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SOX9 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.7ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.7ug/ml].)

WB (Western Blot)

(Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody. Lane 1: SOX9 transfected lysate (56.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody. Lane 1: SOX9 transfected lysate (56.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SOX9 monoclonal antibody, Western Blot analysis of SOX9 expression in HepG2.)

WB (Western Blot) (SOX9 monoclonal antibody, Western Blot analysis of SOX9 expression in HepG2.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.21kD).)

WB (Western Blot) (Western Blot detection against Immunogen (38.21kD).)
Product Categories/Family for anti-SOX9 antibody
References
1. A Molecular Profile of Focal Segmental Glomerulosclerosis from Formalin-Fixed, Paraffin-Embedded Tissue. Hodgin JB, Borczuk AC, Nasr SH, Markowitz GS, Nair V, Martini S, Eichinger F, Vining C, Berthier CC, Kretzler M, D'Agati VD.Am J Pathol. 2010 Oct;177(4):1674-86. Epub 2010 Sep 16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,137 Da
NCBI Official Full Name
transcription factor SOX-9
NCBI Official Synonym Full Names
SRY (sex determining region Y)-box 9
NCBI Official Symbol
SOX9
NCBI Official Synonym Symbols
CMD1; SRA1; CMPD1
NCBI Protein Information
transcription factor SOX-9; SRY (sex-determining region Y)-box 9 protein; SRY-related HMG-box, gene 9
UniProt Protein Name
Transcription factor SOX-9
UniProt Gene Name
SOX9
UniProt Entry Name
SOX9_HUMAN

Similar Products

Product Notes

The SOX9 sox9 (Catalog #AAA25260) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SOX9 (Transcription Factor SOX-9, SOX 9) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOX9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOX9 sox9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOX9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.