Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198220_WB8.jpg WB (Western Blot) (WB Suggested Anti-SOX9 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

Rabbit SOX9 Polyclonal Antibody | anti-SOX9 antibody

SOX9 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
SOX9; CMD1; SRA1; CMPD1; SRXX2; SRXY10
Reactivity
Tested: Human, Rat
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Flow Cytometry, Functional Assay, Western Blot
Purity
Affinity Purified
Synonyms
SOX9, Antibody; SOX9 antibody - C-terminal region; anti-SOX9 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human, Rat
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ
Sequence Length
509
Applicable Applications for anti-SOX9 antibody
FCM/FACS (Flow Cytometry), WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SOX9
Protein Size (#AA)
509 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SOX9 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

product-image-AAA198220_WB8.jpg WB (Western Blot) (WB Suggested Anti-SOX9 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

WB (Western Blot)

(Host: RatTarget Name: SOX10Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

product-image-AAA198220_WB10.jpg WB (Western Blot) (Host: RatTarget Name: SOX10Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SOX9Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA198220_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: SOX9Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SOX10Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

product-image-AAA198220_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SOX10Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

FCM/FACS (Flow Cytometry)

(Researcher: Dr. Ade Kallas, University of tartuApplication: Flow CytometrySpecies + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+ButyratePrimary antibody dilution: 2ug+1x106 cellsSecondary antibody: Chicken anti rabbit-Alexa Fluor 488Secondary antibody dilution: 1:1000)

product-image-AAA198220_FCM15.jpg FCM/FACS (Flow Cytometry) (Researcher: Dr. Ade Kallas, University of tartuApplication: Flow CytometrySpecies + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+ButyratePrimary antibody dilution: 2ug+1x106 cellsSecondary antibody: Chicken anti rabbit-Alexa Fluor 488Secondary antibody dilution: 1:1000)
Related Product Information for anti-SOX9 antibody
This is a rabbit polyclonal antibody against SOX9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SOX9 recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
transcription factor SOX-9
NCBI Official Synonym Full Names
SRY-box 9
NCBI Official Symbol
SOX9
NCBI Official Synonym Symbols
CMD1; SRA1; CMPD1; SRXX2; SRXY10
NCBI Protein Information
transcription factor SOX-9
UniProt Protein Name
Transcription factor SOX-9
UniProt Gene Name
SOX9
UniProt Entry Name
SOX9_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SOX9 sox9 (Catalog #AAA198220) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX9 antibody - C-terminal region reacts with Tested: Human, Rat Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SOX9 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), WB (Western Blot). Researchers should empirically determine the suitability of the SOX9 sox9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGQGTGLYST FTYMNPAQRP MYTPIADTSG VPSIPQTHSP QHWEQPVYTQ. It is sometimes possible for the material contained within the vial of "SOX9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.