Mouse anti-Human, Mouse SP1 Monoclonal Antibody | anti-SP1 antibody

SP1 (Transcription Factor Sp1, TSFP1) APC

Cat. Num. AAA24669

• Reactivity: Human, Mouse
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SP1, Antibody; SP1 (Transcription Factor Sp1, TSFP1) APC; anti-SP1 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone Number: 1A5
• Specificity: Recognizes human SP1. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SP1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa89-199 from human SP1 (NP_612482) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged SP1 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SP1 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1ug/ml].)

WB (Western Blot)

(SP1 monoclonal antibody. Western Blot analysis of SP1 expression in NIH/3T3.)

WB (Western Blot)

(SP1 monoclonal antibody, Western Blot analysis of SP1 expression in Hela NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.21kD).)

Product Categories/Family for anti-SP1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 38372901
• NCBI GeneID: 6667
• NCBI Accession #: NP_612482
• NCBI GenBank Nucleotide #: NM_138473
• UniProt Accession #: P08047; Q86TN8; Q9H3Q5; Q9NR51; Q9NY21; Q9NYE7; E4Z9M7; G5E9M8
• Molecular Weight: 75,824 Da
• NCBI Official Full Name: transcription factor Sp1 isoform a
• NCBI Official Synonym Full Names: Sp1 transcription factor
• NCBI Official Symbol: SP1
• NCBI Protein Information: transcription factor Sp1
• UniProt Protein Name: Transcription factor Sp1
• UniProt Gene Name: SP1
• UniProt Synonym Gene Names: TSFP1
• UniProt Entry Name: SP1_HUMAN