Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282742_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug STAT5B antibody (AAA282742). Western blot was performed from the immunoprecipitate using STAT5B antibody (AAA282742) at a dilution of 1:1000.)

Rabbit anti-Human STAT5B Monoclonal Antibody | anti-STAT5B antibody

[KO Validated] STAT5B Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
STAT5B, Antibody; [KO Validated] STAT5B Rabbit mAb; STAT5; GHISID2; 5B; anti-STAT5B antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
Applicable Applications for anti-STAT5B antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 600-787 of human STAT5B (P51692).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug STAT5B antibody (AAA282742). Western blot was performed from the immunoprecipitate using STAT5B antibody (AAA282742) at a dilution of 1:1000.)

product-image-AAA282742_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug STAT5B antibody (AAA282742). Western blot was performed from the immunoprecipitate using STAT5B antibody (AAA282742) at a dilution of 1:1000.)

WB (Western Blot)

(Western blot analysis of various lysates using [KO Validated] STAT5B Rabbit mAb (AAA282742) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA282742_WB13.jpg WB (Western Blot) (Western blot analysis of various lysates using [KO Validated] STAT5B Rabbit mAb (AAA282742) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and STAT5B knockout (KO) HeLa cells, using [KO Validated] STAT5B Rabbit mAb (AAA282742) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA282742_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and STAT5B knockout (KO) HeLa cells, using [KO Validated] STAT5B Rabbit mAb (AAA282742) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-STAT5B antibody
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 90kDa
Observed MW: 90kDa
UniProt Protein Name
Signal transducer and activator of transcription 5B
UniProt Gene Name
STAT5B
UniProt Entry Name
STA5B_HUMAN

Similar Products

Product Notes

The STAT5B stat5b (Catalog #AAA282742) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] STAT5B Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAT5B can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the STAT5B stat5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KQQAHDLLIN KPDGTFLLRF SDSEIGGITI AWKFDSQERM FWNLMPFTTR DFSIRSLADR LGDLNYLIYV FPDRPKDEVY SKYYTPVPCE SATAKAVDGY VKPQIKQVVP EFVNASADAG GGSATYMDQA PSPAVCPQAH YNMYPQNPDS VLDTDGDFDL EDTMDVARRV EELLGRPMDS QWIPHAQS. It is sometimes possible for the material contained within the vial of "STAT5B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.