<
IF (Immunofluorescence)
(Immunofluorescence analysis of U-2 OS cells using TACC3 Rabbit mAb (AAA282764) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
Rabbit anti-Human TACC3 Monoclonal Antibody | anti-TACC3 antibody
TACC3 Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
TACC3, Antibody; TACC3 Rabbit mAb; ERIC1; Tacc4; ERIC-1; maskin; TACC3; anti-TACC3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQK
Applicable Applications for anti-TACC3 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TACC3 (NP_006333.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of U-2 OS cells using TACC3 Rabbit mAb (AAA282764) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of U-2 OS cells using TACC3 Rabbit mAb (AAA282764) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using TACC3 Rabbit mAb (AAA282764) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using TACC3 Rabbit mAb (AAA282764) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using TACC3 Rabbit mAb (AAA282764) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using TACC3 Rabbit mAb (AAA282764) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon tissue using TACC3 Rabbit mAb (AAA282764) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon tissue using TACC3 Rabbit mAb (AAA282764) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of lysates from 293T cells, using TACC3 Rabbit mAb (AAA282764) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
WB (Western Blot)
(Western blot analysis of lysates from 293T cells, using TACC3 Rabbit mAb (AAA282764) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-TACC3 antibody
TACC3, also known as ERIC 1, belongs to the TACC family. TACC family members TACC1, TACC2, and TACC3 map very closely to the corresponding FGFR1, FGFR2, FGFR3 genes on chromosomes 8, 10, and 4. Subsequently, since they are phylogenetically related, it is proposed that TACC and FGFR have similar roles in cell growth and differentiation. It plays a role in the microtubule-dependent coupling of the nucleus and the centrosome and involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors.
Product Categories/Family for anti-TACC3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 90kDa
Observed MW: 140kDa
Observed MW: 140kDa
UniProt Protein Name
Transforming acidic coiled-coil-containing protein 3
UniProt Gene Name
TACC3
UniProt Synonym Gene Names
ERIC1
UniProt Entry Name
TACC3_HUMAN
Similar Products
Product Notes
The TACC3 tacc3 (Catalog #AAA282764) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TACC3 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TACC3 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TACC3 tacc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSLQVLNDKN VSNEKNTENC DFLFSPPEVT GRSSVLRVSQ KENVPPKNLA KAMKVTFQTP LRDPQTHRIL SPSMASKLEA PFTQDDTLGL ENSHPVWTQK. It is sometimes possible for the material contained within the vial of "TACC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.