Loading...

Skip to main content
Application Data (Detection limit for recombinant GST tagged TAF11 is approximately 0.1ng/ml as a capture antibody.)

Mouse TAF11 Monoclonal Antibody | anti-TAF11 antibody

TAF11 (TAF11 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 28kD, MGC:15243, PRO2134, TAF2I, TAFII28) (APC)

Gene Names
TAF11; TAF2I; PRO2134; TAFII28; MGC:15243
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
TAF11, Antibody; TAF11 (TAF11 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 28kD, MGC:15243, PRO2134, TAF2I, TAFII28) (APC); TAF11 RNA Polymerase II; TATA Box Binding Protein (TBP)-Associated Factor; 28kD; MGC:15243; PRO2134; TAF2I; TAFII28; anti-TAF11 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G9
Specificity
Recognizes TAF11.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TAF11 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TAF11 (NP_005634, 158aa-210aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged TAF11 is approximately 0.1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged TAF11 is approximately 0.1ng/ml as a capture antibody.)

WB (Western Blot)

(TAF11 monoclonal antibody (M04), clone 2G9 Western Blot analysis of TAF11 expression in Hela S3 NE.)

WB (Western Blot) (TAF11 monoclonal antibody (M04), clone 2G9 Western Blot analysis of TAF11 expression in Hela S3 NE.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TAF11 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TAF11 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TAF11 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TAF11 on HeLa cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Application Data (Immunoperoxidase of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])
Related Product Information for anti-TAF11 antibody
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure. [provided by RefSeq]
Product Categories/Family for anti-TAF11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
transcription initiation factor TFIID subunit 11 isoform 1
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 11
NCBI Official Symbol
TAF11
NCBI Official Synonym Symbols
TAF2I; PRO2134; TAFII28; MGC:15243
NCBI Protein Information
transcription initiation factor TFIID subunit 11
UniProt Protein Name
Transcription initiation factor TFIID subunit 11
UniProt Gene Name
TAF11
UniProt Synonym Gene Names
TAF2I
UniProt Entry Name
TAF11_HUMAN

Similar Products

Product Notes

The TAF11 taf11 (Catalog #AAA26085) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TAF11 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF11 taf11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.