<
IHC (Immunohistchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
Rabbit anti-Human TAZ Monoclonal Antibody | anti-WWTR1 antibody
TAZ Rabbit PolymAb
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Affinity purification
Synonyms
TAZ, Antibody; TAZ Rabbit PolymAb; TAZ; anti-WWTR1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAE
Applicable Applications for anti-WWTR1 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA)
Application Notes
WB: 1:1500-1:9000
IHC-P: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
IHC-P: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human TAZ (NP_056287.1)
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohistchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
IHC (Immunohistchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using TAZ Rabbit PolymAb® (AAA28582) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of lysates from HeLa cells using TAZ Rabbit PolymAb® (AAA28582)at 1:3000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
WB (Western Blot)
(Western blot analysis of lysates from HeLa cells using TAZ Rabbit PolymAb® (AAA28582)at 1:3000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
Related Product Information for anti-WWTR1 antibody
Enables transcription coactivator activity. Involved in several processes, including hippo signaling; positive regulation of cell differentiation; and regulation of signal transduction. Located in cytosol and nuclear body.
Product Categories/Family for anti-WWTR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 44kDa
Observed MW: 60kDa
Observed MW: 60kDa
UniProt Protein Name
WW domain-containing transcription regulator protein 1
UniProt Gene Name
WWTR1
UniProt Synonym Gene Names
TAZ
UniProt Entry Name
WWTR1_HUMAN
Similar Products
Product Notes
The WWTR1 wwtr1 (Catalog #AAA28582) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAZ Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAZ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA). WB: 1:1500-1:9000 IHC-P: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the WWTR1 wwtr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNPASAPPPL PPPGQQVIHV TQDLDTDLEA LFNSVMNPKP SSWRKKILPE SFFKEPDSGS HSRQSSTDSS GGHPGPRLAG GAQHVRSHSS PASLQLGTGA GAAGSPAQQH AHLRQQSYDV TDELPLPPGW EMTFTATGQR YFLNHIEKIT TWQDPRKAMN QPLNHMNLHP AVSSTPVPQR SMAVSQPNLV MNHQHQQQMA PSTLSQQNHP TQNPPAGLMS MPNALTTQQQ QQQKLRLQRI QMERERIRMR QEELMRQEAA LCRQLPMEAE. It is sometimes possible for the material contained within the vial of "TAZ, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.