Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201508_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: WWTR1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human WWTR1 Polyclonal Antibody | anti-WWTR1 antibody

WWTR1 Antibody - C-terminal region

Gene Names
WWTR1; TAZ
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WWTR1, Antibody; WWTR1 Antibody - C-terminal region; anti-WWTR1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDF
Sequence Length
400
Applicable Applications for anti-WWTR1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human WWTR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: WWTR1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201508_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: WWTR1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: WWTR1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA201508_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: WWTR1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-WWTR1 antibody
This is a rabbit polyclonal antibody against WWTR1. It was validated on Western Blot

Target Description: WWTR1 is a transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. It regulates the nuclear accumulation of SMADS and has a key role in coupling them to the transcriptional machinery such as the mediator complex. And it regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
WW domain-containing transcription regulator protein 1
NCBI Official Synonym Full Names
WW domain containing transcription regulator 1
NCBI Official Symbol
WWTR1
NCBI Official Synonym Symbols
TAZ
NCBI Protein Information
WW domain-containing transcription regulator protein 1
UniProt Protein Name
WW domain-containing transcription regulator protein 1
UniProt Gene Name
WWTR1
UniProt Synonym Gene Names
TAZ
UniProt Entry Name
WWTR1_HUMAN

Similar Products

Product Notes

The WWTR1 wwtr1 (Catalog #AAA201508) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WWTR1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WWTR1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the WWTR1 wwtr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPTMTPDMRS ITNNSSDPFL NGGPYHSREQ STDSGLGLGC YSVPTTPEDF. It is sometimes possible for the material contained within the vial of "WWTR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.