Mouse TBX3 Monoclonal Antibody | anti-TBX3 antibody

TBX3 (T-Box 3, TBX3-ISO, UMS, XHL) (HRP)

Cat. Num. AAA26438

• Gene Names: TBX3; UMS; XHL; TBX3-ISO
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: TBX3, Antibody; TBX3 (T-Box 3, TBX3-ISO, UMS, XHL) (HRP); T-Box 3; TBX3-ISO; UMS; XHL; anti-TBX3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8H3
• Specificity: Recognizes TBX3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 723

• Applicable Applications for anti-TBX3 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TBX3 (NP_005987, 311aa-410aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in PC-12 (Cat # L012V1).)

WB (Western Blot)

(TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in NIH/3T3 (Cat # L018V1).)

Application Data

(Detection limit for recombinant GST tagged TBX3 is approximately 0.03ng/ml as a capture antibody.)

WB (Western Blot)

(TBX3 monoclonal antibody (M02), clone 8H3 Western Blot analysis of TBX3 expression in IMR-32 (Cat # L008V1).)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-TBX3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 47419905
• NCBI GeneID: 6926
• NCBI Accession #: NP_005987
• NCBI GenBank Nucleotide #: NP_005987.3
• UniProt Accession #: O15119
• NCBI Official Full Name: T-box transcription factor TBX3 isoform 1
• NCBI Official Synonym Full Names: T-box transcription factor 3
• NCBI Official Symbol: TBX3
• NCBI Official Synonym Symbols: UMS; XHL; TBX3-ISO
• NCBI Protein Information: T-box transcription factor TBX3
• UniProt Protein Name: T-box transcription factor TBX3
• UniProt Gene Name: TBX3
• UniProt Synonym Gene Names: T-box protein 3
• UniProt Entry Name: TBX3_HUMAN