Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26571_WB6.jpg WB (Western Blot) (TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in PC-12 (Cat # L012V1).)

Mouse TBX3 Monoclonal Antibody | anti-TBX3 antibody

TBX3 (T-Box 3, TBX3-ISO, UMS, XHL) (PE)

Average rating 0.0
No ratings yet
Gene Names
TBX3; UMS; XHL; TBX3-ISO
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
TBX3, Antibody; TBX3 (T-Box 3, TBX3-ISO, UMS, XHL) (PE); T-Box 3; TBX3-ISO; UMS; XHL; anti-TBX3 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8H3
Specificity
Recognizes TBX3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
723
Applicable Applications for anti-TBX3 antibody
IF (Immunofluorescence), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TBX3 (NP_005987, 311aa-410aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in PC-12 (Cat # L012V1).)

product-image-AAA26571_WB6.jpg WB (Western Blot) (TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in PC-12 (Cat # L012V1).)

WB (Western Blot)

(TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in NIH/3T3 (Cat # L018V1).)

product-image-AAA26571_WB5.jpg WB (Western Blot) (TBX3 monoclonal antibody (M02), clone 8H3. Western Blot analysis of TBX3 expression in NIH/3T3 (Cat # L018V1).)

Application Data

(Detection limit for recombinant GST tagged TBX3 is approximately 0.03ng/ml as a capture antibody.)

product-image-AAA26571_APP4.jpg Application Data (Detection limit for recombinant GST tagged TBX3 is approximately 0.03ng/ml as a capture antibody.)

WB (Western Blot)

(TBX3 monoclonal antibody (M02), clone 8H3 Western Blot analysis of TBX3 expression in IMR-32 (Cat # L008V1).)

product-image-AAA26571_WB3.jpg WB (Western Blot) (TBX3 monoclonal antibody (M02), clone 8H3 Western Blot analysis of TBX3 expression in IMR-32 (Cat # L008V1).)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26571_IF2.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26571_IF.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-TBX3 antibody
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq]
Product Categories/Family for anti-TBX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
T-box transcription factor TBX3 isoform 1
NCBI Official Synonym Full Names
T-box transcription factor 3
NCBI Official Symbol
TBX3
NCBI Official Synonym Symbols
UMS; XHL; TBX3-ISO
NCBI Protein Information
T-box transcription factor TBX3
UniProt Protein Name
T-box transcription factor TBX3
UniProt Gene Name
TBX3
UniProt Synonym Gene Names
T-box protein 3
UniProt Entry Name
TBX3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TBX3 tbx3 (Catalog #AAA26571) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TBX3 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TBX3 tbx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TBX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.