IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Rat spleen using TC10/RHOQ Rabbit mAb (AAA282827) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
Rabbit anti-Human TC10/RHOQ Monoclonal Antibody | anti-RHOQ antibody
TC10/RHOQ Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
TC10/RHOQ, Antibody; TC10/RHOQ Rabbit mAb; ARHQ; TC10; TC10A; RASL7A; HEL-S-42; TC10/RHOQ; anti-RHOQ antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
KEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT
Applicable Applications for anti-RHOQ antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 100-205 of human TC10/RHOQ (P17081).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Rat spleen using TC10/RHOQ Rabbit mAb (AAA282827) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Rat spleen using TC10/RHOQ Rabbit mAb (AAA282827) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of lysates from Rat heart, using TC10/RHOQ Rabbit mAb (AAA282827) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
WB (Western Blot)
(Western blot analysis of lysates from Rat heart, using TC10/RHOQ Rabbit mAb (AAA282827) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
WB (Western Blot)
(Western blot analysis of various lysates using TC10/RHOQ Rabbit mAb (AAA282827) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
WB (Western Blot)
(Western blot analysis of various lysates using TC10/RHOQ Rabbit mAb (AAA282827) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Related Product Information for anti-RHOQ antibody
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The encoded protein is an important signalling protein for sarcomere assembly and has been shown to play a significant role in the exocytosis of the solute carrier family 2, facilitated glucose transporter member 4 and other proteins, possibly acting as the signal that turns on the membrane fusion machinery. Three related pseudogene have been identified on chromosomes 2 and 14.
Product Categories/Family for anti-RHOQ antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 23kDa
Observed MW: 23kDa
Observed MW: 23kDa
UniProt Protein Name
Rho-related GTP-binding protein RhoQ
UniProt Gene Name
RHOQ
UniProt Synonym Gene Names
ARHQ; RASL7A; TC10
UniProt Entry Name
RHOQ_HUMAN
Similar Products
Product Notes
The RHOQ rhoq (Catalog #AAA282827) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TC10/RHOQ Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TC10/RHOQ can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RHOQ rhoq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KEEWVPELKE YAPNVPFLLI GTQIDLRDDP KTLARLNDMK EKPICVEQGQ KLAKEIGACC YVECSALTQK GLKTVFDEAI IAILTPKKHT VKKRIGSRCI NCCLIT. It is sometimes possible for the material contained within the vial of "TC10/RHOQ, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.