Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TESK2 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse TESK2 Monoclonal Antibody | anti-TESK2 antibody

TESK2 (Testis-Specific Kinase 2) (FITC)

Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
TESK2; Monoclonal Antibody; TESK2 (Testis-Specific Kinase 2) (FITC); Testis-Specific Kinase 2; anti-TESK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5G1
Specificity
Recognizes TESK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
542
Applicable Applications for anti-TESK2 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TESK2 (AAH33085, 405aa-542aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GPGTMPLADWQEPLAPPIRRWCSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFSTSGIGLQTQGKQDG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TESK2 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TESK2 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TESK2 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TESK2 on HeLa cell. [antibody concentration 10 ug/ml])

Application Data

(Detection limit for recombinant GST tagged TESK2 is approximately 0.1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged TESK2 is approximately 0.1ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TESK2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.7 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TESK2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.7 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TESK2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.7 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TESK2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.7 ug/ml])

WB (Western Blot)

(Western Blot analysis of TESK2 expression in transfected 293T cell line by TESK2 monoclonal antibody (M08), clone 5G1.Lane 1: TESK2 transfected lysate (60.3 KDa).Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of TESK2 expression in transfected 293T cell line by TESK2 monoclonal antibody (M08), clone 5G1.Lane 1: TESK2 transfected lysate (60.3 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-TESK2 antibody
This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain that is structurally similar to the kinase domains of testis-specific protein kinase-1 and the LIM motif-containing protein kinases (LIMKs). Its overall structure is most related to the former, indicating that it belongs to the TESK subgroup of the LIMK/TESK family of protein kinases. This gene is predominantly expressed in testis and prostate. The developmental expression pattern of the rat gene in testis suggests an important role for this gene in meitoic stages and/or early stages of spermiogenesis. [provided by RefSeq]
Product Categories/Family for anti-TESK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
TESK2 protein
NCBI Official Synonym Full Names
testis associated actin remodelling kinase 2
NCBI Official Symbol
TESK2
NCBI Protein Information
dual specificity testis-specific protein kinase 2

Similar Products

Product Notes

The TESK2 (Catalog #AAA26315) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TESK2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TESK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TESK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.