Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282969_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Mouse kidney using TGF beta Receptor II (TGFBR2) Rabbit mAb (AAA282969) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

Rabbit anti-Human TGF beta Receptor II Monoclonal Antibody | anti-TGFBR2 antibody

TGF beta Receptor II Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
TGF beta Receptor II, Antibody; TGF beta Receptor II Rabbit mAb; AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TBRII; TBR-ii; TGFR-2; tbetaR-II; TGFbeta-RII; TGF beta Receptor II (TGFBR2); anti-TGFBR2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
TWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
Applicable Applications for anti-TGFBR2 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human TGF beta Receptor II (TGFBR2)(NP_003233.4).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Mouse kidney using TGF beta Receptor II (TGFBR2) Rabbit mAb (AAA282969) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA282969_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Mouse kidney using TGF beta Receptor II (TGFBR2) Rabbit mAb (AAA282969) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human placenta using TGF beta Receptor II (TGFBR2) Rabbit mAb (AAA282969) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA282969_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human placenta using TGF beta Receptor II (TGFBR2) Rabbit mAb (AAA282969) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Hep G2 cells using TGF beta Receptor II Rabbit mAb (AAA282969) at 1:8000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA282969_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Hep G2 cells using TGF beta Receptor II Rabbit mAb (AAA282969) at 1:8000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-TGFBR2 antibody
The protein encoded by this gene is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with TGF-beta receptor type-1, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of genes related to cell proliferation, cell cycle arrest, wound healing, immunosuppression, and tumorigenesis. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 65kDa
Observed MW: 65kDa, 85kDa
UniProt Protein Name
TGF-beta receptor type-2
UniProt Gene Name
TGFBR2
UniProt Synonym Gene Names
TGFR-2; TGF-beta receptor type II; TbetaR-II
UniProt Entry Name
TGFR2_HUMAN

Similar Products

Product Notes

The TGFBR2 tgfbr2 (Catalog #AAA282969) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGF beta Receptor II Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TGF beta Receptor II can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TGFBR2 tgfbr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TWETGKTRKL MEFSEHCAII LEDDRSDISS TCANNINHNT ELLPIELDTL VGKGRFAEVY KAKLKQNTSE QFETVAVKIF PYEEYASWKT EKDIFSDINL K. It is sometimes possible for the material contained within the vial of "TGF beta Receptor II, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.