Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (TXNDC4 monoclonal antibody Western Blot analysis of TXNDC4 expression in K-562.)

Mouse anti-Human Thioredoxin Domain-containing Protein 4 Monoclonal Antibody | anti-TXNDC4 antibody

Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (AP)

Gene Names
ERP44; PDIA10; TXNDC4
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Thioredoxin Domain-containing Protein 4; Monoclonal Antibody; Thioredoxin Domain-containing Protein 4 (TXNDC4; Endoplasmic Reticulum Resident Protein 44; ER Protein 44; ERp44; KIAA0573; PDIA10; UNQ532/PRO1075) (AP); anti-TXNDC4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C7
Specificity
Recognizes human TXNDC4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TXNDC4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa30-407 from TXNDC4 (AAH05374) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(TXNDC4 monoclonal antibody Western Blot analysis of TXNDC4 expression in K-562.)

WB (Western Blot) (TXNDC4 monoclonal antibody Western Blot analysis of TXNDC4 expression in K-562.)

WB (Western Blot)

(TXNDC4 monoclonal antibody Western Blot analysis of TXNDC4 expression in A-431)

WB (Western Blot) (TXNDC4 monoclonal antibody Western Blot analysis of TXNDC4 expression in A-431)

Application Data

(Detection limit for recombinant GST tagged TXNDC4 is 1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged TXNDC4 is 1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of TXNDC4 transfected lysate using TXNDC4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TXNDC4 rabbit polyclonal antibody.)

IP (Immunoprecipitation) (Immunoprecipitation of TXNDC4 transfected lysate using TXNDC4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TXNDC4 rabbit polyclonal antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TXNDC4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TXNDC4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of TXNDC4 expression in transfected 293T cell line by TXNDC4 monoclonal antibody Lane 1: TXNDC4 transfected lysate (47kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of TXNDC4 expression in transfected 293T cell line by TXNDC4 monoclonal antibody Lane 1: TXNDC4 transfected lysate (47kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (67.58kD).)

WB (Western Blot) (Western Blot detection against Immunogen (67.58kD).)
Product Categories/Family for anti-TXNDC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
47KD
NCBI Official Full Name
Homo sapiens endoplasmic reticulum protein 44, mRNA
NCBI Official Synonym Full Names
endoplasmic reticulum protein 44
NCBI Official Symbol
ERP44
NCBI Official Synonym Symbols
PDIA10; TXNDC4
NCBI Protein Information
endoplasmic reticulum resident protein 44

Similar Products

Product Notes

The TXNDC4 (Catalog #AAA24398) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Thioredoxin Domain-containing Protein 4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TXNDC4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Thioredoxin Domain-containing Protein 4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.